DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(var)2-HP2 and AT4G02110

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:NP_192120.4 Gene:AT4G02110 AraportID:AT4G02110 Length:1329 Species:Arabidopsis thaliana

Alignment Length:1030 Identity:223/1031 (22%)
Similarity:362/1031 (35%) Gaps:283/1031 (27%)


  Fly  1558 SSDQTKNSFITP-NRSPKSKR--------------------------NVSKE----AKRLDNSFE 1591
            |.|:.:::.:.| |.||...|                          |.||:    .||.|..||
plant   209 SEDEAEDASVKPANTSPLGLRVGAVPAVEISKPGGKDFPLEEGSSLCNTSKDNWLTPKRTDRPFE 273

  Fly  1592 ESQN-----AASESSASKVQKELRTPTASCRKLRV--------LIKRTPTSSLPTNSRKSI---- 1639
            ...:     |...:..|.::...:||.....|:..        .|:|  .|||.|.|||::    
plant   274 AMVSTDLGVAQQHNYVSPIRVANKTPEQGMSKMETDGSTSINRSIRR--HSSLATYSRKTLQRSP 336

  Fly  1640 ----------------------FKKTPAKSKRLTKILESMEKTPSREPSVSL-----------GE 1671
                                  .|.:.|.:...:|...|||:|       ||           ||
plant   337 ETDTLGKESSGQNRSLRMDDKGLKASSAFNTSASKSGSSMERT-------SLFRDLGKIDMLHGE 394

  Fly  1672 VNPDSDPVA---------AESVAVLHESDRDLESNEIPNEEVFEDTEEASAEDTDNKLKKKEDDH 1727
            ..|...|.|         .:|:.|.|.|:..:..   |:..:.::...:|..|....:....|..
plant   395 EFPPMMPQAKFTDGSVSRKDSLRVHHNSEASIPP---PSSLLLQELRPSSPNDNLRPVMSISDPT 456

  Fly  1728 ELEVNDICAASKNPITDDSTKDASSNKSTDSDVLQETKDELSNSLINATQGEDTPIKELTEEEVP 1792
            |.|.    |..|:|.::.:||..|||.....|.|...::.:||     ...::.|.|.|||....
plant   457 ESEE----AGHKSPTSELNTKLLSSNVVPMVDALSTAENIISN-----CAWDEIPEKSLTERMTE 512

  Fly  1793 NNKTVEDESKKQEILKDLEPD--NAALEEDTASTAK-------AAEEMDLYIKEKSNVKSVLAE- 1847
            |....|..|...:....:.|:  .||.|.|.:.:|.       ...|.|:...|.|.:|..|.| 
plant   513 NVLLQEQRSGSPKQNLSVVPNLREAAHELDLSDSAARLFNSGVVPMEADIRTPENSTMKGALDEV 577

  Fly  1848 PETDVTDDEELAQSPIPNSSETTSVTDDPEPSTSSVVKRSLRKREADSSQPDEAAKRKQRQDVEK 1912
            ||..|||       |:...|.|:       |.:..:                   :.|.:|:.| 
plant   578 PERSVTD-------PVMRRSSTS-------PGSGLI-------------------RMKDKQETE- 608

  Fly  1913 SLTGKKEQVKPA---RRRQLAEVEERPSL---KRSKTESEAKSTVQGKYISIIGNETIMSSTTAP 1971
             ||.||...|.:   |.|:...:.::.|:   :.|.|:.......:||             .:||
plant   609 -LTTKKTAPKKSLGTRGRKKNPINQKGSIYLSEPSPTDERNVCLNKGK-------------VSAP 659

  Fly  1972 IRETNREAASTSPSARKSAVQE-AKHVETTKHIILGPPGKKLLHSDSPAAEVKKPMVQTLL--SS 2033
            :...:.:...:||......||: |||::|....:.|...   :.:.|.|.|.|..:|..|:  ..
plant   660 VTGNSNQKEISSPVLNTEVVQDMAKHIDTETEALQGIDS---VDNKSLAPEEKDHLVLDLMVNQD 721

  Fly  2034 TLSLQKPSTLDDGSPLKIRKSLKKSIADENIDGDQSIFSSSSVLNKNTSVVAPRKVNISV---SL 2095
            .|..:.|...|....:.:   |::.:.|...: |.|..:..|.::||||   .||....|   ||
plant   722 KLQAKTPEAADAEVEITV---LERELNDVPTE-DPSDGALQSEVDKNTS---KRKREAGVGKNSL 779

  Fly  2096 LQSKDTQVETA----ASSSETPILTKKEKLKTQKSTKKPEGNKKTESKKKSLVQGPQMKTQK--S 2154
            .:.|.....||    :...:|.|..|:..:|...:..|..|:...:.|:...::....|...  .
plant   780 QRGKKGSSFTAKVGKSRVKKTKISRKENDIKANGTLMKDGGDNSADGKENLALEHENGKVSSGGD 844

  Fly  2155 EEAVSGPKILNKYLKSETESSRKTVSTVTGRKQIGQLEV-LKKPESRKS---EESLVEAISRKKQ 2215
            :..|:|..:           :||..:|........|||| .||.:.||.   ||:.::..|.|| 
plant   845 QSLVAGETL-----------TRKEAATKDPSYAAAQLEVDTKKGKRRKQATVEENRLQTPSVKK- 897

  Fly  2216 SQVQRLSKIDGRKSEGTSLPQPDVSKSETALKAALPKE---------TEFPVQDAEIEKMSKGRG 2271
            ::|.:  |.||.|:..|......:..:|.....|:.:.         ....|:.:..:|.:..:.
plant   898 AKVSK--KEDGAKANNTVKKDIWIHSAEVKENVAVDENCGDVSSDGAQSLVVEKSLAKKEAAAKD 960

  Fly  2272 HQNAVKNTKTEQPKSKPK----TEVRSLQAEAATELMDSMDSQSDV----SDIRATFPESQGIFN 2328
            ..||....:.:..|.|..    .|..|||:       ....|.|.|    |.::.|....:|   
plant   961 PSNAAMQLEFDDNKCKHGKEGIVERSSLQS-------GKKGSSSRVEVGKSSVKKTKKSEKG--- 1015

  Fly  2329 VPGHMTRAISSNRSLAPTPTPMSDSQRNASKERFTPVSDQKKPIRESQTLSKRRARGGRNQPLVS 2393
                        .....|.|.|.|...|::||:.....|.:         |::...||...|:..
plant  1016 ------------SGTEATDTVMKDVGDNSAKEKENIAVDNE---------SRKVGSGGDQSPVAR 1059

  Fly  2394 KRKAGEAEDGTAV--------INPKRPREM--DEEDHP----------QQNDHVQ 2428
            |:.|..|:.||..        :||...|::  |:|..|          |:|::.|
plant  1060 KKVAKSAKTGTKAEKESKQLRVNPLASRKVFQDQEHEPKFFIVSGPRSQRNEYQQ 1114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596
PTZ00449 <739..1091 CDD:185628
PTZ00108 <1132..1374 CDD:240271
PTZ00121 <1720..>2291 CDD:173412 137/616 (22%)
AT4G02110NP_192120.4 BRCT 9..80 CDD:214602
PTCB-BRCT 112..176 CDD:289507
BRCT 1086..1167 CDD:278934 7/30 (23%)
BRCT 1209..1291 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.