DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(var)2-HP2 and RP1

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:XP_016869210.1 Gene:RP1 HGNCID:10263 Length:2163 Species:Homo sapiens

Alignment Length:2275 Identity:422/2276 (19%)
Similarity:796/2276 (35%) Gaps:672/2276 (30%)


  Fly    63 ELLKEGS------GSKSQ----DRRRRPPSPSSSDESNDA--------------------LEALF 97
            |.|::|.      |.|.|    |:.||.|.|..|..:..|                    |....
Human   103 EELEDGESYLCSHGRKVQPVDLDKARRRPRPWLSSRAISAHSPPHPVAVAAPGMPRPPRSLVVFR 167

  Fly    98 CG--KSSQSKLSKRR--ERYESFDSVDDLGEALMRPSHRL------TVPK--------------- 137
            .|  |:.::.|..||  :.:|:|  :..|.|.:.||..:|      .||.               
Human   168 NGDPKTRRAVLLSRRVTQSFEAF--LQHLTEVMQRPVVKLYATDGRRVPSLQAVILSSGAVVAAG 230

  Fly   138 --------------------PSTSQ----AGSKKSQDAAPHRSISNSSSSNI-AMSSGQTY---- 173
                                |..||    .|:.||:.......:|:||.|.| ::||.:|:    
Human   231 REPFKPGNYDIQKYLLPARLPGISQRVYPKGNAKSESRKISTHMSSSSRSQIYSVSSEKTHNNDC 295

  Fly   174 ------------ACPKNKKTN--------SVANKTAVSANGD-----------------KWASGK 201
                        |..||...|        .:......:.:|.                 ||.:..
Human   296 YLDYSFVPEKYLALEKNDSQNLPIYPSEDDIEKSIIFNQDGTMTVEMKVRFRIKEEETIKWTTTV 360

  Fly   202 NKTVTIVKPQKTDLR-PSRLEPKTDPLNLGDLYGDSDSDSSYEYESDFYGDQDSDEEDEPVIDIS 265
            :||......:|:::. |.|.|.::..|.|......:|. |..|..|    :|:....:|..|.::
Human   361 SKTGPSNNDEKSEMSFPGRTESRSSGLKLAACSFSADV-SPMERSS----NQEGSLAEEINIQMT 420

  Fly   266 TDTSRTTSVADTVTPVVSDDEGQEPQSELNQRHANDQESFLSSTYERLQSYLSNLSSAEPPPIYK 330
            ...:.|.|.|......|..|..|..|.:...|........|....:: :|.:.:::......:.:
Human   421 DQVAETCSSASWENATVDTDIIQGTQDQAKHRFYRPPTPGLRRVRQK-KSVIGSVTLVSETEVQE 484

  Fly   331 K---QNSARKSRSNEKKPSSSQQVKHA-NEQSAASDKEA--------NKKERDLEPPEASSSAKS 383
            |   |.|..:.|.:.:..|......|: ::.|:.|:|..        ..:|..||..:.:|..||
Human   485 KMIGQFSYSEERESGENKSEYHMFTHSCSKMSSVSNKPVLVQINNNDQMEESSLERKKENSLLKS 549

  Fly   384 SASKAS----GSRKLYD----------VANNATLE--AVERMSLD-------------LAEQIME 419
            ||..|.    .|:|:.:          ::||:.:|  .|:.:.||             ..::...
Human   550 SAISAGVIEITSQKMLEMSHNNGLPSTISNNSIVEEDVVDCVVLDNKTGIKNFKTYGNTNDRFSP 614

  Fly   420 IDVERSYEFEKRSASKSRSLSRSKIPADSSTSQLGHVRKLTYSSERLDQPEPLGTQLRRSKSESL 484
            |..:.:: |...::...:::|.:  ||..::|.:         :.|:|:   |..:..:.....|
Human   615 ISADATH-FSSNNSGTDKNISEA--PASEASSTV---------TARIDR---LINEFAQCGLTKL 664

  Fly   485 PKRGRP-----RGQKQRKNRGATMEEKSANCRDGEGEPVKRKRGRPRKIIPKEEAKTAETENTIE 544
            ||..:.     ..:|::|:|     :::.|.|..:|:..                       |..
Human   665 PKNEKKILSSVASKKKKKSR-----QQAINSRYQDGQLA-----------------------TKG 701

  Fly   545 SLNTNVPLSIDTSKENPETETVNLEVPIKQDELVSDLDNAKELTGSTNLPQDDIEMASNHQETDL 609
            .||.|              |.:|.:..|.::.:|.|.|:  .|.|.. |.::|::.:....|::.
Human   702 ILNKN--------------ERINTKGRITKEMIVQDSDS--PLKGGI-LCEEDLQKSDTVIESNT 749

  Fly   610 KCAPDRV--ALDKSESTPKVEEEQLCKVD--TPSDTALDESKVSESAKNHIELEDKDKDKEETQK 670
            .|:...:  .:.|:....|:...|..||.  .....:...:|:|..|....|:..:|       |
Human   750 FCSKSNLNSTISKNFHRNKLNTTQNSKVQGLLTKRKSRSLNKISLGAPKKREIGQRD-------K 807

  Fly   671 ESPNGNS---KETNENSVI--VTNEVELPAK-----KAEAKAEAGNIVEESDSQLAEDFKLAEEI 725
            ..|:..|   |.|.||..:  |.|.:|...|     :::|:..:|.:...:...|..  |:.:..
Human   808 VFPHNESKYCKSTFENKSLFHVFNILEQKPKDFYAPQSQAEVASGYLRGMAKKSLVS--KVTDSH 870

  Fly   726 LAAEVGKGVEANEVSVTSVQGEQNPVIEI--VKELEQETISEVVPAQNDQSSVEDQTLADKENPV 788
            :..:..|..:.::|..:::..:|:.....  :..|::....|.:...:.|:.:  |:.....||.
Human   871 ITLKSQKKRKGDKVKASAILSKQHATTRANSLASLKKPDFPEAIAHHSIQNYI--QSWLQNINPY 933

  Fly   789 EKPSPVKAPSSSKDEPPAEENLPAPDQDPIEQQKTPVAKNQQHDKEHNEAPKAESLSVSDIPSSS 853
            ....|:|:                          .||.:|:                     :|.
Human   934 PTLKPIKS--------------------------APVCRNE---------------------TSV 951

  Fly   854 VTPSKKRNHSSPANTPKKSKEIEALQSSVPRRALRSDK-------ATPQNLRESRSKRTL----- 906
            |..|   |:|...|.|..:      ...:....:.|:|       .|..||.:...|..:     
Human   952 VNCS---NNSFSGNDPHTN------SGKISNFVMESNKHITKIAGLTGDNLCKEGDKSFIANDTG 1007

  Fly   907 -----KTELTLLMDD---------TMRRSSPRLGRSPAESHSSHERSPMEKKVTVSK--LAKDLI 955
                 :|::..|.|.         |:.:|:  :.....:||.:.|:|..|||:...:  ||:...
Human  1008 EEDLHETQVGSLNDAYLVPLHEHCTLSQSA--INDHNTKSHIAAEKSGPEKKLVYQEINLARKRQ 1070

  Fly   956 TIDKEKEIELKSLPDASET-KD---VKITKTTTASDTSILTDEN-----PSSSKTEMKKLKGKPL 1011
            :::...:::    |...|| ||   |.:.....||...|...:|     |.|       |.|.|.
Human  1071 SVEAAIQVD----PIEEETPKDLLPVLMLHQLQASVPGIHKTQNGVVQMPGS-------LAGVPF 1124

  Fly  1012 KAKKMSRTSETEVKKAIADSNEDI-----------PSIFSIKCVEEHLTSSESEQKDEKEELLCP 1065
            .:             ||.:|:.::           .|:.|...|:.|..:::|.:.....|:|  
Human  1125 HS-------------AICNSSTNLLLAWLLVLNLKGSMNSFCQVDAHKATNKSSETLALLEIL-- 1174

  Fly  1066 KPQIDCTNTDLEQSTAIETDTEQVEEKRSNRRKSRRIRNEKFKTETDTLSDHLDAKKAENASLEI 1130
                        :..||..:.:.::...:|.              .::.:.|....:.|...:.|
Human  1175 ------------KHIAITEEADDLKAAVANL--------------VESTTSHFGLSEKEQDMVPI 1213

  Fly  1131 SMRPKCTLETQQSDPVTAKNKRNSG-----------------------RLSRKEKSVINAAKSEK 1172
            .:...|:....||.|..::|:|..|                       ..|..|...:|.|.|.|
Human  1214 DLSANCSTVNIQSVPKCSENERTQGISSLDGGCSASEACAPEVCVLEVTCSPCEMCTVNKAYSPK 1278

  Fly  1173 DKSPSAISQSTERKQLLNENPS-----KKDKKTEQSGNKKEAVVGPL-DKTETSSSTNIIDKKSN 1231
            :..                |||     ......:|:...|...:|.: ..|:|..|.....:|.|
Human  1279 ETC----------------NPSDTFFPSDGYGVDQTSMNKACFLGEVCSLTDTVFSDKACAQKEN 1327

  Fly  1232 ESFDSAMQPSDR-------------LNQKESAFTKLSSISSPKKIMKDQD--KDLDALS----KG 1277
            .:::.|. |.|.             ||.||:.:|  .::.|.:::.:..|  |||:.|:    |.
Human  1328 HTYEGAC-PIDETYVPVNVCNTIDFLNSKENTYT--DNLDSTEELERGDDIQKDLNILTDPEYKN 1389

  Fly  1278 G----DSNPTIRD-------TGEDSRQTDKKHQEND------TKHEEEDSSKLKANIDETKSSSE 1325
            |    .|:..:.:       ..|...:.||||...|      .:..:::::....:::|.::|. 
Human  1390 GFNTLVSHQNVSNLSSCGLCLSEKEAELDKKHSSLDDFENCSLRKFQDENAYTSFDMEEPRTSE- 1453

  Fly  1326 KDAEPISKDSSQDSAKPRLSKPKSRNKRKKNEKKPNDSIAESDIEGGFQVNTETVQATCSTPSES 1390
               ||.|..:|..|::..:|:.:|..:.:.::    ..|..:.:.||.|...|.:|         
Human  1454 ---EPGSITNSMTSSERNISELESFEELENHD----TDIFNTVVNGGEQATEELIQ--------- 1502

  Fly  1391 NKKDMVKSDETNEEPNLSETEI-GRIRKRGQAFHIENPKDDLHITPQNENQSIAGVNFEKQVPLP 1454
               :.|::.:|.|..::|...| ...|..|..:.|.:.:  |...|..:....:..|.||     
Human  1503 ---EEVEASKTLELIDISSKNIMEEKRMNGIIYEIISKR--LATPPSLDFCYDSKQNSEK----- 1557

  Fly  1455 ESVESDTPIMKIPTKTYLMCTKNKTSLLSASEDPDIVLEPQKLITTSKGDSNPDLDNANNLETSS 1519
            |:.|.:|.::|:..||.      :|...|.| .||:....:..:|:...|..||.|:....:|||
Human  1558 ETNEGETKMVKMMVKTM------ETGSYSES-SPDLKKCIKSPVTSDWSDYRPDSDSEQPYKTSS 1615

  Fly  1520 TQDP-------KEHEF-------SDQTFTDNSDII-----PSCTKKSQIVFPTTPTKSSDQTKNS 1565
             .||       :|.|:       :.:.....:|||     |..|:||| |.|....:.....|.|
Human  1616 -DDPNDSGELTQEKEYNIGFVKRAIEKLYGKADIIKPSFFPGSTRKSQ-VCPYNSVEFQCSRKAS 1678

  Fly  1566 -FITPNRSPKSKRNVSKEAKRLDNSFEESQNAASESSA--SKVQKELRTPTASCRKLRVLIKRTP 1627
             :.:..:|..|...||..:..|....||.|:....|:.  :..:.::..|..         |:..
Human  1679 LYDSEGQSFGSSEQVSSSSSMLQEFQEERQDKCDVSAVRDNYCRGDIVEPGT---------KQND 1734

  Fly  1628 TSSLPTNSRKSIFKKTPAKSKRLTK---ILESMEKTPSREPSVSLGEVNPDSDPVAAESVAVLHE 1689
            .|.:.|:..:.:...   |.|.|.|   :|....:.|.         :..::|..:.:::.    
Human  1735 DSRILTDIEEGVLID---KGKWLLKENHLLRMSSENPG---------MCGNADTTSVDTLL---- 1783

  Fly  1690 SDRDLESNEIPNEE--------VFEDTEEASAEDTDNKLKKK------------EDDHE--LEV- 1731
               |..|:|:|...        ..::...:..|:....|:.|            |..||  |:| 
Human  1784 ---DNNSSEVPYSHFGNLAPGPTMDELSSSELEELTQPLELKCNYFNMPHGSDSEPFHEDLLDVR 1845

  Fly  1732 NDICAASKNPITDDSTKDASSNKSTDSDVLQETKDELSNSLINATQGEDTPIKELTEEEVPNNKT 1796
            |:.||  |..|.:..|::..|::|      :.....:::|.|:|                 .||.
Human  1846 NETCA--KERIANHHTEEKGSHQS------ERVCTSVTHSFISA-----------------GNKV 1885

  Fly  1797 --VEDESKKQEILKDLEPDNAALEEDTASTAKAAEEMDLYIKEKSNVKSVLAEPETDVTDDEELA 1859
              |.|::.|.:.|......:..|:|     |.:.:::.....:...:.:|:.:|..:  :|...|
Human  1886 YPVSDDAIKNQPLPGSNMIHGTLQE-----ADSLDKLYALCGQHCPILTVIIQPMNE--EDRGFA 1943

  Fly  1860 ---QSPIPN--------SSETTSVTDDPEPSTSSVVKRSLRKREADSSQPDEAAKRKQRQDVEKS 1913
               :|.|.|        ......:..|.........|.|:|:...|::..|...:.......:  
Human  1944 YRKESDIENFLGFYLWMKIHPYLLQTDKNVFREENNKASMRQNLIDNAIGDIFDQFYFSNTFD-- 2006

  Fly  1914 LTGKKEQVKPARRRQLAEVEERPSLKRSKTESEAKSTVQGKYIS--IIGNETIMSSTTAPIRETN 1976
            |.||:.:.|   |.....:||..:||:.:.:.:.:..:...:.|  ::||  :.|:|.....:||
Human  2007 LMGKRRKQK---RINFLGLEEEGNLKKFQPDLKERFCMNFLHTSLLVVGN--VDSNTQDLSGQTN 2066

  Fly  1977  1976
            Human  2067  2066

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596 42/265 (16%)
PTZ00449 <739..1091 CDD:185628 67/402 (17%)
PTZ00108 <1132..1374 CDD:240271 59/307 (19%)
PTZ00121 <1720..>2291 CDD:173412 56/288 (19%)
RP1XP_016869210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.