DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(var)2-HP2 and Lmpt

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:NP_996113.2 Gene:Lmpt FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster

Alignment Length:2557 Identity:470/2558 (18%)
Similarity:850/2558 (33%) Gaps:767/2558 (30%)


  Fly   445 PADSSTSQLGHVRKLTYSSERLDQPEPLGTQLRR-SKSESLPK--------------RGRPRGQK 494
            |.|||........:|....||||:      |::. ::.|:|..              |..|.|.|
  Fly    43 PGDSSVDAAADAEELPRMRERLDK------QIKEAAEREALAGTNVMQDGVLYVNGIRVDPAGDK 101

  Fly   495 QRKNRGATMEEKSANCRDGEGEPVKRKRGRPRKIIPKEEAKTAETENTIESLNTNVPLSIDTSKE 559
            ::     .:..:.|..:..|.:        .|:.:.:.|||..|..           |.:...||
  Fly   102 RQ-----ALAAELARQQQIEAD--------TRRQLAEAEAKLVEER-----------LRVQREKE 142

  Fly   560 NPETE---TVNLEVPIKQDELVSDLDNAKELTGSTNLPQDDIEMASNHQETDLKCAPDRVALDKS 621
            ..|.:   .|..|...::::...:|...:|                          .:|..|:..
  Fly   143 ESEEQQRKLVEAERQREREQAEKELQEQRE--------------------------AERRQLEAE 181

  Fly   622 ESTPKVEEEQLCKVDTPSDTALDESKVSESAKNHIELEDKDKDKEETQK---ESPNGNSKETNEN 683
            |:..|..|              :|.|  |..:|...|.|.::::||.::   |:.....:|.:|.
  Fly   182 ENQRKQRE--------------NEEK--ERLENERRLIDAEREREENERRLQEAEEQREREESER 230

  Fly   684 SVIVTNEVELPAKKAEAKAEAGNIVEESDSQLAE-----------------------DFKLAEEI 725
            .::|.......|:..:.:||...|:.|:::..||                       |.::.|.:
  Fly   231 RIVVAERQREQAEAEKERAEQQRILAEAEAAQAERRLFDAEIQRERDQADEEGQALRDAEIVERL 295

  Fly   726 LAAEVGKGVEANEVSVTSVQGEQNPVIEIVKELEQETISEVVPAQNDQSSVEDQTL----ADKEN 786
            ||||       .|:|.::.:.|......|. |..:..||.....:..|..:|:...    |::|.
  Fly   296 LAAE-------RELSPSATESELEEDAAIA-EQSRRLISSRTDLEQKQRMIEENARRFLEAEEEM 352

  Fly   787 PVEKPSPVKAPSSSKDE-------PPAEENL------PAPDQDPIEQ---QKTPVAKNQQHDKEH 835
            .:.:...::| |.||:|       .|..|.|      |...|:|.|:   .|......|....|.
  Fly   353 VMLQQRQLQA-SHSKEEADEYAGMEPVVEELCVKKVAPPRFQEPPEEPMVHKVKTQFGQGSGPED 416

  Fly   836 NEAPKAESLS---VSDIPSS--------------SVTPSKKRNH-SSPANTPKKSKEIEALQ--- 879
            ..:.|:::|:   |||..||              |..||.:.|. .|....|:...:|:.:|   
  Fly   417 AYSAKSKTLTFPGVSDEGSSLEPKTPFSIQQSSFSTQPSDEGNRIESERPEPEGEDQIQEVQYTE 481

  Fly   880 ------------------SSVPRRAL--RSDKATPQNLRESRSKRTLKTELTLLMDDTMRRSSPR 924
                              .|..|||.  |....:..:.||||:.|..:.::...:::...|...|
  Fly   482 DYLRSLDGIKNRPLMREDGSGRRRAFKKRRSSGSSNSSRESRASRDEELKMFTSLEEEELRHGDR 546

  Fly   925 LGRSP----------AESHSSHERSPMEKKVTVSKLAKDLITIDKEKEIELKSLPDASET----- 974
            ...:|          .:||..|:|||          ||| :....|....|:.|.:.|..     
  Fly   547 EDYNPIKYTSEPTLRVKSHRRHKRSP----------AKD-VRPTAESTTSLEMLGEESTNPWGEV 600

  Fly   975 -----KDVKITKTTTA--SDTSILTDENPSSSKTEMKKLKGKPLKAKKMSRTSETEVKKAIADSN 1032
                 ||.:..|...|  .|...:..|.||..:...::...:| |:......:|.:.::|:|   
  Fly   601 VPEHYKDTEFWKREKALSIDEEEIELERPSRGEDVEEEATNEP-KSSSFEEATEAQNEQAVA--- 661

  Fly  1033 EDIPSIFSIKCVEEHLTSSESEQKDEKEELLCPKPQI----DCTNTDLEQSTAIETDTEQVEEKR 1093
                      .:::.|:..:.:::.||:     .||.    |...::|:.|.|.|   ||.....
  Fly   662 ----------ALKQQLSKEQLDKEAEKD-----NPQAVDTSDSNKSNLQTSIAAE---EQSRGGS 708

  Fly  1094 SNRRKSRRIRNEKFKTETDTLSDHLDAKKAENASLEISMRPKCT---LETQQSDPVTAKNKRNSG 1155
            ...|:|.|:         |.:..:.:...|......:..:|..|   :..||.|  ||.      
  Fly   709 PGLRRSPRM---------DEMEHYPERWSASQEQQSVQQQPPRTAPAINVQQPD--TAP------ 756

  Fly  1156 RLSRKEKSVINAAKSEKDKSPSAISQSTERKQLLNENPSKKDKKTEQSGNKKEAVVGPLDKTETS 1220
              .|.:..::....|:.....::::.|..|....|.:|:.|:             |..|...:|.
  Fly   757 --WRDQYGLLMEGLSDFYDFTASVNPSRSRSASRNPSPAPKN-------------VANLMDGDTE 806

  Fly  1221 SSTNIIDKKSNESFDSAMQPSDRLNQKESAFTKLSSISSPKKIMKDQDKDLDALSKGGDSNPTIR 1285
            .|..:.|..........:.....|...||...:..|.:...::.                  |:.
  Fly   807 RSLEVYDDTQEGVMAGELNCESVLQLLESNLNETESTNDQLQVQ------------------TVA 853

  Fly  1286 DTGEDSRQTDKKHQENDTKHEEEDSSKLKANIDETKSSSEKDAEP-ISKDSSQDSAKPRLSKPKS 1349
            |...|.:..      ....||..:||.|.|.::      |:..|| :.:..|:..::.|...|.|
  Fly   854 DDARDGKSI------LPMVHEPLESSALGAVLE------ERGREPSVGRIQSRSRSRSRSPLPTS 906

  Fly  1350 RN------KRKKNEKKPNDSIAESDIEGGFQVNTETVQATCSTPSESNKKDMVKSDETNEEPNLS 1408
            .|      ||::...|.||.:||              :.:.|:|.:|  .::..||.....|.|.
  Fly   907 ENLEKSIHKRRERLIKQNDELAE--------------RLSHSSPEDS--MEIETSDNGRLSPTLE 955

  Fly  1409 ET------EIGRIRKRGQAFHIENPKDDLHITPQNENQSIAGVNFEKQVPLPESVESDTPIMKIP 1467
            .|      ||..:        .:.|.:|...||:.                          |::.
  Fly   956 VTLPQPVIEINEM--------ADEPMEDAETTPEE--------------------------MRLF 986

  Fly  1468 TKTYLMCTKNKTSLLSASEDPDIVLEPQKLITTSKGDSNPDLDNANNLETS-STQDPKEHEFSDQ 1531
            .:| |...:|..|                   .|:..|...|..|.|:|.| .::..|..:.:|:
  Fly   987 VET-LRAERNARS-------------------RSRSRSRSPLPTAGNIEKSLESRRLKRIQHNDE 1031

  Fly  1532 TFTDNSD-------IIPSCTKKS-QIVFPT-------TPTKSSDQTKNSFITPNRSPKSKRNVSK 1581
            .|....|       ||.|.:..| .:..||       .|.:::..|:   ..|..:|:|...:  
  Fly  1032 IFEKLHDQMSSPQIIIESASPPSLPLPLPTISIEIAEPPEENASHTE---AEPEDTPESMARL-- 1091

  Fly  1582 EAKRLDNSFEESQ-NAASESSASKVQKELRTPTASCRKLRVLIKRTPTSSLPTNSRKSIFKKTP- 1644
                    ||:.: |.....|.|:.:..|.|                    |.|..:|:.|:.. 
  Fly  1092 --------FEQLRLNRVRSHSRSRSRSPLPT--------------------PANLEQSVQKRRER 1128

  Fly  1645 --AKSKRLTKILESMEKTPSREPSVSLGEVNPDSDPVAAESVAVLHE--SDRDLESNEIPNEEVF 1705
              |::.:..::|:...:||  ||...|             :|..::|  .::|        |:|.
  Fly  1129 LIAQNDQFFEVLQERARTP--EPETRL-------------TVEYVYEYVQEKD--------EQVG 1170

  Fly  1706 EDTEEASAEDTDNKLKKKE---DDHELEVN----DICAASKNPITDDST-KDASSNKSTDSDVLQ 1762
            |..::.|...:.::.:.:|   ||..|.:|    ::....||....:|. ...:..:..|.|.|:
  Fly  1171 EGRDKRSLSPSRSRSQSQEKALDDFHLMLNLEGSELRTLRKNSEELESVLAVGAKQREVDMDALE 1235

  Fly  1763 E---TKDELSNSLINATQGEDTPIKELTEEEVPNNKTVEDESKKQEILKDLEPDNAALEEDTAST 1824
            :   ..:|:...:::.|..|...:.|:|.|....::||      .|:.:||:      :|..||.
  Fly  1236 KLHNANEEIELRVLSPTNSELERVVEMTRENPDMDRTV------SEVARDLQ------DELMASG 1288

  Fly  1825 AK----AAEEMDLYIKEKSNVKSVLAEPETDVTDDEELAQSPIPNSSETTSVTDDPEPSTSSVVK 1885
            .|    ..|.:||...:...::...|:        .:.::||.|.||...:       ...:..:
  Fly  1289 FKRSTYVGESLDLGSDQFKELRREAAQ--------FQRSRSPSPGSSMDYA-------REQAAAQ 1338

  Fly  1886 RSLRKREADSSQPDEAAKRKQRQDVEKSLTGKKEQVKPAR----RRQLAEVEERPSLKRS----- 1941
            |.|:....||........:.:....|:  ||:.|.:..|:    |.:.||.:...|..||     
  Fly  1339 RELQTAILDSLTESRLGAKPKTYSEER--TGEFEDISAAQLDDLRHRTAEFQRSRSQSRSPLREV 1401

  Fly  1942 ------KTESE-AKSTVQGKYISIIGNETIMSSTTAPIRETNREAASTSPSARKSAVQEAKHVET 1999
                  ..|:| ||..:|.:.:..:...:|.....:  |..|.:...:...|..||:......:.
  Fly  1402 ELTQLRDIEAESAKRELQDQLLDRLAASSINFENFS--RHLNADFLDSERRASDSALMGDMEPDE 1464

  Fly  2000 TKHIILGPPGKKLLHSDSPAAE--------VKKPMVQTL------LSSTLSLQKPSTLDDG-SPL 2049
            ..|.     .:..|..:.|..|        :.:..|:||      |.......:|:...|. ||:
  Fly  1465 YHHF-----RRYSLAQEQPVEEYPSDDYVYISQIEVRTLTGTRTWLKEDFYTHEPNDFSDSKSPV 1524

  Fly  2050 KIRKSLKKSI-ADE----NIDGDQSIFSSSSV-----LNKNTSVVAPRKVNISVSLLQSKDTQVE 2104
            :...|..::: |.|    ..|...:|:|...|     |::..|           |...|:||:..
  Fly  1525 RDEDSWARAVLAAEAEAAEFDSTNAIYSYDIVGDHENLDQERS-----------SSNDSEDTRQT 1578

  Fly  2105 TAASSSETP--------ILTKKEKLKTQKSTKKPEGNKKTESKKKSLVQGPQMKTQKSEE----- 2156
            ......|..        |....|  :||.:.:......:.|..:::..:......|..||     
  Fly  1579 VVEIDDEDEFEFELDEGISDNNE--RTQPTDESHHDTSECEEAERNADRYENRGAQDWEEVDDVE 1641

  Fly  2157 ----------AVSG-----------PKILNKYLKSETESS-RKTVSTVTGRKQIGQLEVLKKPES 2199
                      ||.|           .:|.|:.:|:..:|. .:...|:...:....|...:|.:|
  Fly  1642 DFLDYGFDDGAVGGATPYSDPDSFIEQIYNEAIKNRKQSGILREYETIVQEQLPSDLSESEKEKS 1706

  Fly  2200 RKSEE---------SLVEAISRKKQSQVQ----RLSKIDGRKSEGTSLPQPD-VSKSETALKAAL 2250
            ....|         .|..:.|..:.|.|.    .:.:.|.|.||...|.... |::..|.|:...
  Fly  1707 GSDSEKYALWAKTRELERSHSGTRHSDVDIALGLIPESDHRDSEMRYLGDAHVVARQSTRLRTRY 1771

  Fly  2251 PKETEFPV----QDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVRSLQAEAATELMDSMDSQS 2311
            ....:..|    .|.|::...|.:...|..||.:.:..:          :.|.:.::....|.:.
  Fly  1772 GFNPKLEVGDLEDDIEVDLNYKPKREYNWRKNFRLDDNE----------EGERSVQVKTEEDEEQ 1826

  Fly  2312 DVSDIRATFPESQGIFNVPGHMTRAISSNRSLAPTPTPMSDSQRNASKERFTPVSDQKKP----- 2371
            :..|   .|.|..|                        ..|.::...:|.:   .|.::|     
  Fly  1827 EARD---QFEEEFG------------------------WQDREQELEEELY---QDHEQPLYANE 1861

  Fly  2372 ----IRESQTLSKRR-ARGGRNQPLVSKRKAGEAEDGTAVINPKRPREMDEEDHPQQNDHVQESA 2431
                |...:.|..|| :.||.:..|.|:....|       |.|..|.|:     ||:.:.::|..
  Fly  1862 ENGEIENVELLENRRISLGGESITLFSRSPVRE-------ILPDVPEEL-----PQEEEALEEQP 1914

  Fly  2432 FAAFPVKITAASSVIPQVVRSTGNTVPQNISPRKLCVKINRRPYNKWLRSTQERNEEQEGSRNVT 2496
            .|..|::...|.                  .|:|       :...|.||...:..||        
  Fly  1915 EAVAPLEDLPAE------------------KPKK-------KKSKKKLRKGSKTEEE-------- 1946

  Fly  2497 SLPLLGETSETDSAAESMSESILQSQVQSEPAIQPLPASQPDSCTLQASDLRIRESSAQLAPIAA 2561
                |.:.:::|:...|...|  ..|..::|     |..:..|.....|.|...|.:....|.:.
  Fly  1947 ----LRDDNDSDTQMGSSRRS--DDQEPTDP-----PKRKTRSRRSSRSSLTNEEPNGGSGPFSP 2000

  Fly  2562 YDSPAANDSSTSPALDIAPESAQTAKATLNTALCPSTEKHLPDEPTLLESSKKVAEPQKLQTFQA 2626
            ..|.|....|.....:..|:..:..::|                      .|:..:.:|..|.:.
  Fly  2001 RSSLAFVGESLEGIAEFEPQEREEEQST----------------------KKRTKKRKKTSTKEC 2043

  Fly  2627 KCLPVPIPEVKSEPE-DIMDEHSPNEPMPMVAAAPATPQPHAITEDAGPDTIQVNTLGVSTSSRP 2690
            |      .|.|.|.: ..:|:...:..:   |||.|...|.:::.:..|::...|.|...::.:.
  Fly  2044 K------EEAKEETQTQAIDDSQLDRAL---AAALAEIAPVSVSTNLTPESTHQNLLSTISTGQS 2099

  Fly  2691 LELHSIPSASDPDGNPNAIGQT 2712
            :.:....|..:..|:|::...|
  Fly  2100 VCITPASSIEEIGGSPSSTSTT 2121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596 58/295 (20%)
PTZ00449 <739..1091 CDD:185628 91/439 (21%)
PTZ00108 <1132..1374 CDD:240271 47/252 (19%)
PTZ00121 <1720..>2291 CDD:173412 126/680 (19%)
LmptNP_996113.2 GBP_C <103..201 CDD:303769 24/164 (15%)
ARGLU 110..255 CDD:291991 36/206 (17%)
coiled coil 170..181 CDD:293879 3/37 (8%)
coiled coil 190..201 CDD:293879 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.