DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(var)2-HP2 and Dmp1

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:XP_008768216.1 Gene:Dmp1 RGDID:2508 Length:584 Species:Rattus norvegicus

Alignment Length:684 Identity:125/685 (18%)
Similarity:225/685 (33%) Gaps:231/685 (34%)


  Fly  1176 PSAISQSTERKQLLNENPSKKDKKTEQSGNKKEAVVGPLDKTETSSSTNIIDKKSNESFDSAMQP 1240
            |.|..|:||           .:...|::||..::...|::...:..|....:.::|.....:.:.
  Rat    98 PVARYQNTE-----------SESSEERTGNLAQSPPPPMNSESSEESKVSPEGQANSDHTDSSES 151

  Fly  1241 SDRLNQKESAFTKLSSISSPKKIMKDQDKDLDALSKGGDS--------NPTIRDTGEDSRQTDKK 1297
            .:.|....|.:.....:|  |....|.||:.|....|.|:        .|..|..|..|| .|..
  Rat   152 GEELGSDRSQYRPAGGLS--KSAGMDADKEEDEDDSGDDTFGDEDNGPGPEERQWGGPSR-LDSD 213

  Fly  1298 HQENDTKHEEEDSSKLKANIDETKS------SSEKDAEPISKDSSQDSAKPRLSKPKSRNKRKKN 1356
            ....||....|||:..:.:..:|.|      |.|.|:.|.:.||:|||             ..:.
  Rat   214 EDSADTTQSSEDSTSQENSAQDTPSDSKDHHSDEADSRPEAGDSTQDS-------------ESEE 265

  Fly  1357 EKKPNDSIAESDIEGGFQVNTETVQATCSTPSESNKKDMVKSDETNEEPNLSETEIGRIRKRGQA 1421
            .:....|..||....|.:.:.|.:|                    :::|..:.::.|..|     
  Rat   266 YRVGGGSEGESSHGDGSEFDDEGMQ--------------------SDDPGSTRSDRGHTR----- 305

  Fly  1422 FHIENPKDDLHITPQNENQSIAGVNFEKQVPLPESVESDTPIMKIPTKTYLMCTKNKTSLLSASE 1486
                              .|.||:..|:                                     
  Rat   306 ------------------MSSAGIRSEE------------------------------------- 315

  Fly  1487 DPDIVLEPQKLITTSKGDSNP----DLDNANNLETSSTQDPKEHEFSDQTFTDNSDIIPSCTKKS 1547
                          ||||..|    |.|::.::|.||.:..:....|::  .|..::..|.::::
  Rat   316 --------------SKGDHEPTSTQDSDDSQDVEFSSRKSFRRSRVSEE--DDRGELADSNSRET 364

  Fly  1548 QIVFPTTPTKSSDQTKNSFITPNRSPKSKRNVSKEAKRLDNSFEES---QNAASESSASKVQKEL 1609
            |          ||.|::.     ||.:..|:.::|......|.|:|   |:.:||||     :|.
  Rat   365 Q----------SDSTEDF-----RSKEESRSETQEDTAETQSQEDSPEGQDPSSESS-----EEA 409

  Fly  1610 RTPTASCRKLRVLIKRTPTSSLPTNSRKSIFKKTPAKSKRLTKILESMEKTPSREPSVSLGEVNP 1674
            ..|:.                                        ||..::.....|.|.|: ||
  Rat   410 GEPSQ----------------------------------------ESSSESQEGVASESRGD-NP 433

  Fly  1675 DSDPVAAESVAVLHESDRDLESNEIPNEEVF-----EDTEEASAEDTDNKLKKKEDDHELEVNDI 1734
            |:.....:        .||.||:|......|     :.|||....:::..|...|:..| ...|.
  Rat   434 DNTSQTGD--------QRDSESSEEDRLNTFSSSESQSTEEQGDSESNESLSLSEESQE-SAQDE 489

  Fly  1735 CAASKNPITDDSTKDASSNKSTDSDVLQETKDELSNSLINATQGEDTPIKELTEEEVPNNKTVED 1799
            .::|:..:...|....|.::.:.|:  |:::.|         :..|:..::.:..:..:|.|...
  Rat   490 DSSSQEGLQSQSASRESRSQESQSE--QDSRSE---------ENRDSDSQDSSRSKEESNSTGST 543

  Fly  1800 ESKKQE-ILKDLEPDNAALEEDTASTAKAAEEMD 1832
            .|.::: ..|::|.||..|..|........::.|
  Rat   544 SSSEEDNHPKNIEADNRKLIVDAYHNKPIGDQDD 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596
PTZ00449 <739..1091 CDD:185628
PTZ00108 <1132..1374 CDD:240271 47/212 (22%)
PTZ00121 <1720..>2291 CDD:173412 21/115 (18%)
Dmp1XP_008768216.1 DMP1 81..584 CDD:284637 125/685 (18%)
PHA02664 <192..275 CDD:177447 23/97 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.