DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and krt5

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571231.2 Gene:krt5 ZFINID:ZDB-GENE-991110-23 Length:566 Species:Danio rerio

Alignment Length:399 Identity:120/400 (30%)
Similarity:198/400 (50%) Gaps:73/400 (18%)


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD-TVNRETSNLKAVYEKELAAARKL 106
            |.||||:::.||:|.|.:||::|.||.:|..|..:.:|.|: |..|  ||:.|::|..:|..|:.
Zfish   154 RTQEKEQIKTLNNRFASFIDKVRFLEQQNKVLETKWSLLQEQTTTR--SNIDAMFEAYIANLRRQ 216

  Fly   107 LDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLADR 170
            ||....||.|||.::|.:                     :|....::|:| :|:|          
Zfish   217 LDGLGNEKMKLEGELKNM---------------------QNLVEDFKNKYEDEIN---------- 250

  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
                   |..|:|||.:.     |:|.::|..:.:|:||.:..||::|:.|...:..:||.|.:|
Zfish   251 -------KRAAVENEFVL-----LKKDVDAAYMNKVELEAKVDSLQDEINFLRAIFEEELRELQS 303

  Fly   236 RRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGS 300
              ||:.:.:...:.......:...:.|:|.|||.....:|.|.|..|..:.:.::::|.:..   
Zfish   304 --QIKDTSVVVEMDNSRNLDMDAIVAEVRAQYEDIANRSRAEAESWYKQKFEEMQSSAGKYG--- 363

  Fly   301 ALATEEVRLMRTKIDGLN---AKLQN----LEDTNAGLNARIRELENLLDTERQRHNQYIASLEA 358
                :::|..:.:|..||   ::|||    ::...|.|.|:|.|.|...:...:.....|..||.
Zfish   364 ----DDLRNTKAEIADLNRMISRLQNEIEAVKGQRANLEAQIAEAEERGELAVKDAKLRIKDLED 424

  Fly   359 ELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHL 423
            .|||.:.:||.|::|||.||::|::||:|||.|.|||.|||.|  |.|.|...|        .|:
Zfish   425 ALQRAKQDMARQVREYQELMNVKLALDIEIATYRKLLEGEESR--IASGGNTAT--------IHI 479

  Fly   424 TASASSRSG 432
            ..|:||..|
Zfish   480 QESSSSSGG 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 109/365 (30%)
ATP-synt_B <67..>142 CDD:304375 22/76 (29%)
MreC <178..>224 CDD:302802 15/46 (33%)
LTD 473..574 CDD:279300
krt5NP_571231.2 Keratin_2_head <129..153 CDD:292825
Filament 156..467 CDD:278467 109/365 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.