DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and lmnb3

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001076823.1 Gene:lmnb3 XenbaseID:XB-GENE-920613 Length:582 Species:Xenopus tropicalis

Alignment Length:573 Identity:196/574 (34%)
Similarity:327/574 (57%) Gaps:30/574 (5%)


  Fly    16 STSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNL 80
            :||||......:|  .|.||.||||.||.||||:|:|||||||.||:|:|:||.:.|.|..:|..
 Frog     2 ATSTPSRAREHAS--AAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEE 64

  Fly    81 AQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVA 145
            .::..:||.:||:.:||.|||.||||||:||.|:|:|::::.::.|:...|:.|..||..:.::|
 Frog    65 KEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLA 129

  Fly   146 ENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLEN 210
            :|..|..|::.|........:|:.::..|:|.:|...:...|...|.|..|||..|.|.||||||
 Frog   130 QNLLRDLESKLNTKEADLATALSGKRGLEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLEN 194

  Fly   211 QNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINR 275
            :.|:::|:|.|:..:|.||:.|.|.|....|.|||.....::|:||.::|||||..:|.|:...:
 Frog   195 KMQTIKEQLDFQRNIHEQEVKEMRKRHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYK 259

  Fly   276 EEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELEN 340
            |::|..:..:::|.:.||.:.:..::...||:...:.::|.|:::|...:..|:.|.|::|||::
 Frog   260 EQLERNFSAKLENAQLAAAKNSDYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQD 324

  Fly   341 LLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIE 405
            :||.....|.:.:...:.|:..:|..:..||:||:.|:|:|::||:||.||.|:|.|||:||.:.
 Frog   325 MLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLS 389

  Fly   406 -SPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSE 469
             ||.:.:|          ::.:::|:|.|::...:|....  :|.|..||...|:.|        
 Frog   390 PSPSQRST----------VSRASTSQSSRLSRGKKRKLEE--TGRSVTKRAYKVVQE-------- 434

  Fly   470 YSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGD-EELAFKFSRGSKVLGGAS 533
                |::.|.:.:.:.|.||.:::|.|...|:.:|.||.:.|..|. .|:|:|......:.....
 Frog   435 ----ASSTGPVSVEDIDPEGNYVRLLNNTEEDHSLHGWVVRRKHGSLPEIAYKLPCRFVLKSEQR 495

  Fly   534 VTIWSVDAGTAHDPPNNLVMK--KKWPVANSMRSVLANADKEVRVLSIYNTCG 584
            ||||:..||..|.||.:||.|  |.|...:....:|.::.:|....:||...|
 Frog   496 VTIWAAGAGAVHSPPTDLVWKSHKNWGTGDIKIILLDSSGEECAERTIYRVIG 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 132/356 (37%)
ATP-synt_B <67..>142 CDD:304375 30/75 (40%)
MreC <178..>224 CDD:302802 19/46 (41%)
LTD 473..574 CDD:279300 32/104 (31%)
lmnb3NP_001076823.1 Filament 29..385 CDD:278467 132/356 (37%)
LCD1 301..>464 CDD:286837 54/187 (29%)
LTD 434..542 CDD:279300 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 403 1.000 Inparanoid score I1755
OMA 1 1.010
OrthoDB 1 1.010 D204815at33208
OrthoFinder 1 1.000 FOG0000811
OrthoInspector 1 1.000 T129173
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.930

Return to query results.
Submit another query.