DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and Des

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_071976.1 Gene:Des RGDID:620686 Length:469 Species:Rattus norvegicus

Alignment Length:421 Identity:126/422 (30%)
Similarity:213/422 (50%) Gaps:74/422 (18%)


  Fly     7 TLNTRVSRAS-TSTPVGGAST--SSRVGATSPTS--------------------PTRTSRQQEKE 48
            ::.:||.:.| ||...||..:  :||:|.|...|                    .|||:   ||.
  Rat    48 SVTSRVYQVSRTSGGAGGLGSLRASRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTN---EKV 109

  Fly    49 ELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKE 113
            |||.||||.|.|.:::|.||.:|:.|..|:|..:   .||.:.:..:||:|:...|:.::....:
  Rat   110 ELQELNDRFANYFEKVRFLEQQNAALAAEVNRLK---GREPTRVAELYEEEMRELRRQVEVLTNQ 171

  Fly   114 KAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAK 178
            :|:::::...|.::...||.:|.::.:....||||                              
  Rat   172 RARVDVERDNLIDDLQRLKAKLQEEIQLREEAENN------------------------------ 206

  Fly   179 ELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISE 243
                        |...|..::|.||||:|||.:.:||.||:||..:||.:|:.|.:::.|.:..:
  Rat   207 ------------LAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQ 259

  Fly   244 IDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVR 308
            ::..:|:   ..|..:|:::|.|||.....|..|.|..|.:::.:|..|||:.......|.:|:.
  Rat   260 VEMDMSK---PDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMM 321

  Fly   309 LMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQE 373
            ..|.:|.....::..|:.||..|..::||||:...:|...:...||.||.|::.::||||..|:|
  Rat   322 EYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLRE 386

  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNI 404
            ||.|:::|::||:|||.|.|||.|||.|:|:
  Rat   387 YQDLLNVKMALDVEIATYRKLLEGEESRINL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 109/356 (31%)
ATP-synt_B <67..>142 CDD:304375 17/75 (23%)
MreC <178..>224 CDD:302802 16/46 (35%)
LTD 473..574 CDD:279300
DesNP_071976.1 Head 1..108 16/63 (25%)
Filament_head 9..105 CDD:282575 14/57 (25%)
Filament 106..414 CDD:278467 109/359 (30%)
Coil 1A 109..140 15/31 (48%)
Linker 1 141..150 2/12 (17%)
Coil 1B 151..251 33/142 (23%)
Linker 12 252..267 2/18 (11%)
Interaction with NEB. {ECO:0000250|UniProtKB:P17661} 267..414 54/147 (37%)
Coil 2A 268..286 6/18 (33%)
Linker 2 287..294 3/7 (43%)
Coil 2B 295..411 43/116 (37%)
Tail 412..469 3/7 (43%)
Interaction with CRYAB. {ECO:0000250|UniProtKB:P17661} 437..452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.