DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and ngs

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001122237.1 Gene:ngs ZFINID:ZDB-GENE-080722-29 Length:539 Species:Danio rerio

Alignment Length:529 Identity:135/530 (25%)
Similarity:248/530 (47%) Gaps:88/530 (17%)


  Fly     2 SARRVTLNTRVSRASTSTPV---------GGASTSSRVGATSPTS----PTRTSRQQEKEELQHL 53
            :.||....||.||.::|..:         |||..:..:.|.:..:    .||||   |::|:..|
Zfish    69 TGRRALSGTRKSRMTSSVSMGTLCLGMGFGGAGGAVDLDAAAAENQAFLSTRTS---ERKEMIAL 130

  Fly    54 NDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLE 118
            |||||.||:::|:||..|..|..|::..:.. :.:.|.|:.:||::|...:|:.|:     .|::
Zfish   131 NDRLAVYIEKVRSLEQSNKLLETEIDAIKGH-HVKPSGLRLLYEEQLREMKKIADQ-----MKIQ 189

  Fly   119 IDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALE 183
            .|:                     .||..:|...:....:|  ||.::|..|||.|       ||
Zfish   190 RDL---------------------AVAAKDAMAGQLEMLKV--KYEEALEARKKAE-------LE 224

  Fly   184 NERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRL 248
            .|..|..:|       |.|.||:.||.:.::|..||.|..::|.:|:.|..::....::::|...
Zfish   225 IEAFRPDVD-------AATSARIALEKRLENLEVELEFLQRIHKKEIEELMAQIYGSVAKVDVAF 282

  Fly   249 SRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTK 313
            |.   ..|..:|::::.||:.....|.::::..|..:.|:|...::|..:.:..|.||:...:.:
Zfish   283 SL---PDLASALKQIQAQYDSIAAQNLQDMDAWYKGKFQDLNNVSSRHMETARSAREEIMGYKKE 344

  Fly   314 IDGLNAKLQNLEDTNAGLNARIREL-ENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGL 377
            :.....:|..|::.|..|...|:|. ||....|.:.|.: |.:|:.||:.::.::|..|:|||.|
Zfish   345 MQNKQRELDALKNRNEALLLMIKEAQENYRKEEEELHTR-IETLKEELRSIKGKIALLLREYQDL 408

  Fly   378 MDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSA 442
            :::|:||::||..|.||:.||:.||:....|.......:||.   |.:|.|:.|...      :|
Zfish   409 LNVKMSLEIEITTYRKLIEGEDSRLSSMVGGLSLMGGSVSSG---LVSSVSAYSSAA------AA 464

  Fly   443 TPGISGSSAVK--RRRTVIDESEDRTLSEYSVNAA-------------AKGDLEIIEADVEGRFI 492
            ...:|.:::.|  ...:.::.:...::.|::...|             .|.|.:.|:.|.|.|.|
Zfish   465 AAAVSSAASEKMISSNSTLNHNHHESVEEFTHEQAVEMTERKTVLIRTVKTDEDTIQKDTEERTI 529

  Fly   493 KLHNKGTEE 501
            .:.....|:
Zfish   530 TISGAADED 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 98/357 (27%)
ATP-synt_B <67..>142 CDD:304375 14/75 (19%)
MreC <178..>224 CDD:302802 15/46 (33%)
LTD 473..574 CDD:279300 9/43 (21%)
ngsNP_001122237.1 Filament_head 28..121 CDD:282575 13/52 (25%)
Filament 122..432 CDD:278467 99/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.