DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and krt8.2

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001016797.1 Gene:krt8.2 XenbaseID:XB-GENE-876686 Length:386 Species:Xenopus tropicalis

Alignment Length:412 Identity:97/413 (23%)
Similarity:199/413 (48%) Gaps:72/413 (17%)


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLL 107
            |.||||:::.||::...:||::|:||.:|..|..:|.|.::. :...||:..:.:......::.:
 Frog    11 RNQEKEQIKGLNNQFVNFIDKVRDLEKQNKILETQLALLKEK-DAYKSNIDQITQVSANRLKQQI 74

  Fly   108 DETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKK 172
            |....||.||::::..:....::||                     |||.:...:.||       
 Frog    75 DALLHEKEKLQMELHNMQGLVEELK---------------------NRYEDDINRRNQ------- 111

  Fly   173 FEDQAKELALENERL--RRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
                     :||:.:  ::.|||       ..|.:||.|::..:|.:|:.:..|::.:||.|.  
 Frog   112 ---------IENDFVLTKKDLDD-------AYLHKVDNESKLDTLTDEIQYLKQLYDEELKEL-- 158

  Fly   236 RRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGS 300
            ..|::.:::...:....:.:::..:.|::.||:...:.:::|.|..|:.:|::::....|     
 Frog   159 EHQVQNAKVTVAMDNSRDLEMKHIMDEVKAQYQAMAQKSQQEAEYWYNCKIEDMENQVKR----- 218

  Fly   301 ALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQ--------YIASLE 357
              ..||::.::.:::.||..:|.....|..|..:...||:.: :..:.|.:        :|..||
 Frog   219 --NNEELKALKNEVNDLNRMIQRANSENEALKNQRANLESAI-SMAEEHGEDAVRNAKSHIHDLE 280

  Fly   358 AELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSH 422
            ..|:|.:.:||.:::|||.||:||::||:|||.|.|||.|||.|::.:.|       .:.:|...
 Frog   281 EALKRAKQDMALKVREYQELMNIKLALDIEIATYRKLLEGEETRMHGQKP-------NLQANAID 338

  Fly   423 LTASASSRSGRVTPSGRRSATP 444
            ..||..:...:..|..:.:..|
 Frog   339 KLASTLNFDVKSAPPVKAAPNP 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 89/366 (24%)
ATP-synt_B <67..>142 CDD:304375 15/75 (20%)
MreC <178..>224 CDD:302802 11/48 (23%)
LTD 473..574 CDD:279300
krt8.2NP_001016797.1 Filament 13..324 CDD:278467 89/366 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.