DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and zgc:65851

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_955828.1 Gene:zgc:65851 ZFINID:ZDB-GENE-030131-9669 Length:562 Species:Danio rerio

Alignment Length:527 Identity:137/528 (26%)
Similarity:234/528 (44%) Gaps:95/528 (18%)


  Fly     2 SARRVTLNTRV--------SRASTSTPVGGASTSSRV----GATSP-----------TSPTRTSR 43
            |..|||::.|.        :..|.|..:..:|..|::    ||..|           |:..:..|
Zfish    29 SPSRVTVSYRSAPQQQQHRTYGSPSPMITSSSYRSKLASGRGAFQPDNVDLTQTTAITNELKIIR 93

  Fly    44 QQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLD 108
            ..|||:||.||||...:|:::.|||..|..|..|:.|.:...| |.|.|..:||:|:...|..::
Zfish    94 TNEKEQLQGLNDRFVTFIEKVHNLEQHNKVLEAEVALLRQRHN-EPSRLHDLYEQEIRELRARVE 157

  Fly   109 ETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKF 173
            |.|.||:::.:|..::.:..:.:|.:||::.:....|||:.:.|                     
Zfish   158 ELAHEKSQMHLDCVQMNDALERVKDKLDEEARAREEAENSLKGY--------------------- 201

  Fly   174 EDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQ 238
                                 ||.::..||:|::||.:.:||.:|:||..:||.:||.|.::..|
Zfish   202 ---------------------RKDVDDATLSRLELEKKVESLLDEIAFLRRVHEEELQELQASLQ 245

  Fly   239 IEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALA 303
            .....::..:|:   ..|..:|:::|.|||.....|:::.|..|.::...:..||.|........
Zfish   246 ATQVSVEMDVSK---PDLAVALKDIRVQYESLSSRNQQQAEEWYRSKFATVTEAAARNNDALKQT 307

  Fly   304 TEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMA 368
            .:|:...|.::.....:::.|:..|..|..::.|:|:....|.......|..||:.|:..:.||:
Zfish   308 KDELSEYRRQLQSRTLEIEALKAHNEALERQLAEMEDRHSNEIGELQDTIQQLESALRSTKGEMS 372

  Fly   369 HQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASA----SS 429
            ..|:|||.|:::|::||:|||||.|||.|||.||              ||.|..:..||    :|
Zfish   373 RHLREYQDLLNVKMALDIEIAAYRKLLEGEECRL--------------SSVGGAILQSAYSYPTS 423

  Fly   430 RSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKL 494
            |:..::...|..|.|........:......::.|::...|......|..:.|..|...||     
Zfish   424 RTYTLSAYRRAGAKPETEEEEKQEEEEEEEEQEEEKEEEEAEEEEEAGEEAEEGEEQEEG----- 483

  Fly   495 HNKGTEE 501
               |.||
Zfish   484 ---GDEE 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 101/356 (28%)
ATP-synt_B <67..>142 CDD:304375 22/75 (29%)
MreC <178..>224 CDD:302802 12/46 (26%)
LTD 473..574 CDD:279300 8/30 (27%)
zgc:65851NP_955828.1 Filament_head 8..94 CDD:282575 14/65 (22%)
Filament 95..405 CDD:278467 101/356 (28%)
DUF1640 <311..400 CDD:285090 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.680 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.