DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and KRT73

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_778238.1 Gene:KRT73 HGNCID:28928 Length:540 Species:Homo sapiens

Alignment Length:450 Identity:115/450 (26%)
Similarity:204/450 (45%) Gaps:72/450 (16%)


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD-TVNRETSNLKAVYEKELAAARKL 106
            |.||:|:::.||::.|.:||::|.||.:|..|..:..|.|. .:|...:||:.:.|..::..||.
Human   129 RAQEREQIKVLNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPILEGYISNLRKQ 193

  Fly   107 LDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRK 171
            |:..:.::.:|:.:::.:.|..:|.|.|.:::..:.|.|||                        
Human   194 LETLSGDRVRLDSELRSVREVVEDYKKRYEEEINKRTTAEN------------------------ 234

  Fly   172 KFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSR 236
                   |..:           |:|.::|...::|:|:.:..:|..|:.|...::..|..:.:| 
Human   235 -------EFVV-----------LKKDVDAAYTSKVELQAKVDALDGEIKFFKCLYEGETAQIQS- 280

  Fly   237 RQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSA 301
             .|..:.|...:.......|...:.|:|.|||...|.::.|.|.||..:.|.|:.||.|......
Human   281 -HISDTSIILSMDNNRNLDLDSIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLK 344

  Fly   302 LATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDE 366
            ....|:..:...|..|.:::::::...|.|...|.:.|...|...:.....:..||..||:.::|
Human   345 HTKNEISELTRLIQRLRSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEE 409

  Fly   367 MAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRS 431
            :|..|:|||.|:.:|:|||:|||.|.|||.|||.|::    |..|....||...|.:...|.:.:
Human   410 LARMLREYQELLSVKLSLDIEIATYRKLLEGEECRMS----GEYTNSVSISVINSSMAGMAGTGA 470

  Fly   432 G------------RVTPSGRRSATPG--ISGSSAVKRR---RTVID------ESEDRTLS 468
            |            ..:.||..|..||  ::||.....|   ||.:.      :|:.:||:
Human   471 GFGFSNAGTYGYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLA 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 93/357 (26%)
ATP-synt_B <67..>142 CDD:304375 18/76 (24%)
MreC <178..>224 CDD:302802 9/46 (20%)
LTD 473..574 CDD:279300
KRT73NP_778238.1 Head 1..131 1/2 (50%)
TrbL <10..93 CDD:294888
Keratin_2_head 16..128 CDD:292825
Filament 131..444 CDD:278467 93/357 (26%)
Coil 1A 132..167 13/35 (37%)
Linker 1 168..186 5/18 (28%)
Coil 1B 187..278 22/133 (17%)
Linker 12 279..302 4/25 (16%)
FlgN 298..429 CDD:298847 39/131 (30%)
Coil 2 303..441 46/138 (33%)
Tail 442..540 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.