DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and Krt17

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_997710.1 Gene:Krt17 RGDID:1303181 Length:433 Species:Rattus norvegicus

Alignment Length:385 Identity:115/386 (30%)
Similarity:178/386 (46%) Gaps:81/386 (21%)


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDET 110
            ||..:|:||||||.|:|::|.||..|:.|..:              ::..|:|:.....:     
  Rat    84 EKATMQNLNDRLASYLDKVRALEEANTELEVK--------------IRDWYQKQAPGPAR----- 129

  Fly   111 AKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAE-------NNARLYENRYNEVNGKYNQSLA 168
                     |....::..:|||    .|...|||..       :||||..:.:            
  Rat   130 ---------DYSAYYQTIEDLK----NKILVATVDNASILLQIDNARLAADDF------------ 169

  Fly   169 DRKKFE-DQAKELALENE--RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQEL 230
             |.||| :||..:::|.:  .|||.||:|       ||||.|||.|.::|:||||:..:.|.:|:
  Rat   170 -RTKFETEQALRMSVEADINGLRRVLDEL-------TLARADLEMQIENLKEELAYLKKNHEEEM 226

  Fly   231 TETRSRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKA 291
            ...|       .::.|.::.:.:|    .|.:.|.|:|||||.....||::.|..:.::.:.|  
  Rat   227 NALR-------GQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEEL-- 282

  Fly   292 AANR-AAQGSAL---ATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQY 352
              || .|..|.|   ...|:..:|..:..|..:||:.....|.|...:.|.||....:..:....
  Rat   283 --NREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGL 345

  Fly   353 IASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTT 412
            |.|:|.:|.::|.||..|.|||:.|:|:|..|:.|||.|.:||.||:..|....|..|.|
  Rat   346 IGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVT 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 111/373 (30%)
ATP-synt_B <67..>142 CDD:304375 11/75 (15%)
MreC <178..>224 CDD:302802 20/48 (42%)
LTD 473..574 CDD:279300
Krt17NP_997710.1 Head 1..83
Filament 84..394 CDD:278467 111/373 (30%)
Coil 1A. {ECO:0000255} 84..120 16/50 (32%)
Linker 1. {ECO:0000255} 121..138 2/31 (6%)
Coil 1B. {ECO:0000255} 139..230 39/115 (34%)
Zinc_peptidase_like <215..296 CDD:301362 24/92 (26%)
Linker 12. {ECO:0000255} 231..250 3/19 (16%)
Coil 2. {ECO:0000255} 251..392 49/145 (34%)
Tail. {ECO:0000255} 393..433 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.