DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and Krt35

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001008820.1 Gene:Krt35 RGDID:1305300 Length:455 Species:Rattus norvegicus

Alignment Length:443 Identity:119/444 (27%)
Similarity:195/444 (44%) Gaps:60/444 (14%)


  Fly     9 NTRVSRA--STSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENEN 71
            |.|:|..  :...|.||.:|...:|.........|.  .|||.:|.||||||.|::::|.||.||
  Rat    60 NYRLSSCLPALCLPTGGFATGYSMGGGWFGEGILTG--NEKETMQSLNDRLASYLEKVRQLEQEN 122

  Fly    72 SRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLD 136
            :.|...:   ::...::...:...|:.......:|..:|...||           ||..|..::|
  Rat   123 ASLESRI---REWCEQQVPYMCPDYQSYFRTMEELQKKTLCSKA-----------ENARLVVQID 173

  Fly   137 KKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAE 201
                       ||:|..:.:..   ||...::.|:..|       .:...|||.||||       
  Rat   174 -----------NAKLAADDFRT---KYETEVSLRQLVE-------ADINGLRRILDDL------- 210

  Fly   202 TLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEA----KLQQSLQE 262
            ||.:.|||.|.:||:|||....:.|.:|:...|       .::..||:.:.:|    .|.:.|.|
  Rat   211 TLCKADLEAQVESLKEELLCLKKNHEEEVNSLR-------CQLGDRLNVEVDAAPPVDLNRVLDE 268

  Fly   263 LRDQYEGQMRINREEIELLYDNEIQNL-KAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLED 326
            :|.|||..:..||.:.|..||.:.:.| :.....:.|..:..::.:.|.|| ::.|..:||..:.
  Rat   269 MRCQYETLVENNRRDAEDWYDTQTEELNQQVVTSSEQLQSCQSDIIELRRT-VNSLEIELQAQQS 332

  Fly   327 TNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAY 391
            ....|::.:.|.|....::..:....|.|:|::|..:|.::..|.||||.|:|::..|:.||..|
  Rat   333 MRDALDSTLAETEARYSSQLAQMQCLIGSVESQLGEIRADLERQNQEYQVLLDVRARLECEINTY 397

  Fly   392 DKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATP 444
            ..||..|:.:|.. :|..|......|........|.|:.:.|.|.|.|....|
  Rat   398 RGLLESEDSKLPC-NPCAPDYSPSKSCLPCLPAVSCSTGAARTTCSPRPVCVP 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 99/361 (27%)
ATP-synt_B <67..>142 CDD:304375 14/75 (19%)
MreC <178..>224 CDD:302802 18/46 (39%)
LTD 473..574 CDD:279300
Krt35NP_001008820.1 Filament 96..407 CDD:278467 99/361 (27%)
MIT_CorA-like <192..>334 CDD:294313 46/164 (28%)
DUF5082 305..408 CDD:293493 29/104 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.