DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and lmnl3

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_694505.2 Gene:lmnl3 ZFINID:ZDB-GENE-020424-4 Length:584 Species:Danio rerio

Alignment Length:584 Identity:188/585 (32%)
Similarity:308/585 (53%) Gaps:69/585 (12%)


  Fly    17 TSTPV----GGASTSSRVGATSP--TSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLT 75
            ||||:    ..|..:||....||  .||||.:|.||||:|:.||||||.||:|:|.||.:.|.:.
Zfish     5 TSTPMERSASAAVRASRRSGASPCTVSPTRLTRLQEKEDLRQLNDRLANYIERVRQLEADKSSMQ 69

  Fly    76 QELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTK 140
            ..|...:::..||..|::.:||.|||.|||.||.||.|:|:|:|:..:|.|::..|..|.:||..
Zfish    70 ILLEEKEESSLREVGNVRRLYESELADARKSLDATANERARLQIEFSQLQEDHRKLAARNNKKEC 134

  Fly   141 EATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLAR 205
            |.|.|.:..|..|...|.....:...|:..::.|.:..||..:...|...|..|:.||.:|.|.|
Zfish   135 ELTAAVDRWRNLEVALNAKEADFANLLSTNRRLETEISELKTQVPALEAALQKLKTQLNSEMLRR 199

  Fly   206 VDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQ 270
            ||.|||.|:|:|:|.|:..:..||:.|.|||.:..:.|:|....:::|.||.:::::|||::|.|
Zfish   200 VDAENQIQTLQEQLDFQKHLGEQEVREMRSRHESRLLELDCGRQKEFEGKLAEAMKQLRDEHETQ 264

  Fly   271 MRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARI 335
            :|..::|:|..::.:::|.|..|.:.:..:....||:...:.:::....::.||:.....|.||:
Zfish   265 IRQYKDELEKTFNAKLENAKQTAVKNSDFAFSTKEELAGTKLRLESQTQQINNLQKQVVCLEARV 329

  Fly   336 RELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEER 400
            .||:..|:.|||...|.::..:.|:..:|.:|..||:||:.|:|:|:.||:||.||.|:|.|||:
Zfish   330 LELQQTLEHERQVSQQKLSQQQQEMAALRLQMQEQLEEYENLLDVKLMLDMEINAYRKMLEGEEK 394

  Fly   401 RLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDR 465
            |||                     .|.|.....::|..::|.          |:|:      .|.
Zfish   395 RLN---------------------QSLSPIQQTLSPIIQQSR----------KKRK------HDA 422

  Fly   466 TLSEYSVN------AAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGD-EELAFKFS 523
            |.|.:|.|      ::.:|.:.|.|.|::||:|||.|....:..::||||.:...: .::.|.|.
Zfish   423 TCSGFSPNYRLSQHSSCRGPVSIEEVDLDGRYIKLKNASDRDQVVSGWQLRKSEAEAPDIVFCFP 487

  Fly   524 RGSKVLGGASVTIWSVDA----GTAHDPPNNLVMK--KKWPVANSMRSVLANADKEVRVLSIYN 581
            ....:..|..:|:|:..|    |:|.|    |::.  :.|.         :.||..|.:|:|.|
Zfish   488 SPCVMNAGHMLTVWAAAAVDQCGSASD----LLLSTHQSWG---------SFADVRVSLLNIQN 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 129/356 (36%)
ATP-synt_B <67..>142 CDD:304375 30/75 (40%)
MreC <178..>224 CDD:302802 20/46 (43%)
LTD 473..574 CDD:279300 28/114 (25%)
lmnl3NP_694505.2 Filament 39..395 CDD:278467 129/356 (36%)
LTD 436..544 CDD:279300 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D204815at33208
OrthoFinder 1 1.000 FOG0000811
OrthoInspector 1 1.000 T128637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45721
Phylome 1 0.910 0.960 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.