DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and lmna

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_694503.1 Gene:lmna ZFINID:ZDB-GENE-020424-3 Length:659 Species:Danio rerio

Alignment Length:614 Identity:221/615 (36%)
Similarity:346/615 (56%) Gaps:59/615 (10%)


  Fly    19 TPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD 83
            ||  |...|||.|.|:..||||.||.||||:|.:||||||.|||::|:||.||:.|...:..::.
Zfish     3 TP--GQKRSSRGGVTNVLSPTRISRLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESET 65

  Fly    84 TVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENN 148
            .::||.|.:||.||.|||.|||.||..|||:|:|::::.::.|:..:||.|..|  |||.:....
Zfish    66 EISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGK--KEADLESAL 128

  Fly   149 ARL--YENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQ 211
            |||  .|:..|..:...:.:|.:::..|.:.::|..:..:|...|:|.:|||:.|.|.|||.||:
Zfish   129 ARLKDLESLLNSKDASLSTALGEKRTLEVEVRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENR 193

  Fly   212 NQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINRE 276
            .|:|:|||.|:..::::||.|::.|.:..:.|||....:.||:||..:|.:||:|:|.|:||.:|
Zfish   194 IQTLKEELEFQKNIYSEELRESKRRYESRVVEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKE 258

  Fly   277 EIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENL 341
            |||..|:::::|.:::|.|.:.....|.||::..|.:::|::::|..|:...|...|:|||||..
Zfish   259 EIEKTYNSKLENARSSAERNSHLVGAAHEELQQTRVRMEGVSSQLSQLQKQLAAREAKIRELEEA 323

  Fly   342 LDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIE- 405
            |..||....:.:...|.|:..||..|..||.|||.|:|||::||:||:||.|||.|||.||.:. 
Zfish   324 LSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSP 388

  Fly   406 --SPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDR--- 465
              .|.|..|.:..|.:|||.         ||.    :|:|...|..||.|||  :.|...|.   
Zfish   389 SPPPARGVTVTRSSGSGSHT---------RVV----QSSTSRTSSGSAKKRR--LNDNDSDASSV 438

  Fly   466 -----TLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTR-IAGDEELAFKFSR 524
                 |.:.....|:|.|.:.:.|.|:||:|::|:||..::.:|..||:.| |.....:.:||..
Zfish   439 VGGTVTRTRIFQQASASGRVTVDEVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIVYKFPP 503

  Fly   525 GSKVLGGASVTIWSVDAGTAHDPPNNLVMK--KKWPVANSMRSVLANA----------------D 571
            ...:..|.:||||:..||..|.||::||.|  ..|...:..::.|.::                |
Zfish   504 KFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMAMRKVTRTLFQD 568

  Fly   572 KEVRVLSIYNTCGTCD--------ICRHC 592
            :|...::.::|||..:        :|..|
Zfish   569 EEDDEMAAHSTCGDSEYNLRSRTVLCGSC 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 145/358 (41%)
ATP-synt_B <67..>142 CDD:304375 32/75 (43%)
MreC <178..>224 CDD:302802 20/46 (43%)
LTD 473..574 CDD:279300 35/120 (29%)
lmnaNP_694503.1 Filament 27..383 CDD:278467 145/358 (41%)
Uso1_p115_C 102..202 CDD:282695 34/102 (33%)
BAR <237..>350 CDD:299863 40/113 (35%)
DUF972 295..>359 CDD:283750 23/64 (36%)
Exonuc_VII_L <322..400 CDD:280721 34/78 (44%)
LTD 451..559 CDD:279300 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1890
OMA 1 1.010
OrthoDB 1 1.010 D204815at33208
OrthoFinder 1 1.000 FOG0000811
OrthoInspector 1 1.000 T128637
orthoMCL 1 0.900 OOG5_128723
Panther 1 1.100 O PTHR45721
Phylome 1 0.910 0.966 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2618
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.