DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and ifa-3

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_510649.3 Gene:ifa-3 WormBaseID:WBGene00002051 Length:581 Species:Caenorhabditis elegans

Alignment Length:606 Identity:156/607 (26%)
Similarity:277/607 (46%) Gaps:91/607 (15%)


  Fly     4 RRVTLNTRVSRASTSTPVGG---------ASTSSRVGATSP-----TSPTRTSRQQEKEELQHLN 54
            |.||.:|:    :..||..|         ..|||.....||     .|..|..|::||:|:..||
 Worm    19 RTVTSSTQ----NYGTPASGNRVLKIVTETHTSSVASGLSPYGQGAASTIRDDREREKKEITELN 79

  Fly    55 DRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEI 119
            ||||.||.::|.|..:|.:|..:||:.|....:.|.::|.:||.|:..|..::.||.|:..:.|.
 Worm    80 DRLASYIGKVRFLAAQNRKLEADLNVLQSRFGKSTGSVKIMYEMEITTATNVVKETGKDHEEAEK 144

  Fly   120 DIKRLWEENDDLKPRLDKKTKEATVAENNARLYE------NRYNEVNGKYNQSLADRK--KFEDQ 176
            :|.::.::.|:|:.:.::..|..  ||:..::.|      |...|:|      |..|:  ..|::
 Worm   145 EIGKIKDQLDELRKKFEEAQKGR--AEDRLKIDELLVTLSNLEAEIN------LLKRRIALLEEE 201

  Fly   177 AKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIE- 240
            ...|..||.||..:|..:|.:|:.|||.|:|.:|:..::.||:.|..:....||.:.:::...: 
 Worm   202 VARLKKENFRLTSELQRVRSELDQETLLRIDNQNKVTTILEEIDFMKRGFETELKDLQAQAARDT 266

  Fly   241 ISEIDGRLSRQY-EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALAT 304
            .||     :|:| :.:|..|::::|.:|:..|..||.::|......:|.:....||.........
 Worm   267 TSE-----NREYFKNELMNSIRDIRAEYDRFMAGNRNDLESWSQIRVQEINTQTNRQNAEINHKR 326

  Fly   305 EEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAH 369
            :||:.:.:::..|.:|...|...|..|..::.:|...|:.:::.:...:...:|:::::|:|...
 Worm   327 DEVKRLHSQVSELKSKHAELAARNGLLEKQLEDLNYQLEDDQRSYEAALNDKDAQVRKLREECQA 391

  Fly   370 QLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRV 434
            .|.|.|.|:|.|.:||.|:..|.::|                                   .|..
 Worm   392 LLVELQMLLDTKQTLDGELKVYRRML-----------------------------------EGNS 421

  Fly   435 TPSGRRSATPGISGSSAVKRR------RTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIK 493
            ..:|.|.....:..:||:...      |.|..|...||    |...:|||::.|.|...||:|:.
 Worm   422 EENGLRQLVEKVVRTSAINEEVDTETMRVVKGEHSSRT----SYQRSAKGNVSIKEVSPEGKFVI 482

  Fly   494 LHNKGTE-EINLTGWQLTR-IAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK-- 554
            |.|...: |..|..|:|.| |.|..|:.|.|.....:....:|.|::...|.| :||..||.:  
 Worm   483 LENTHRDKEEPLGDWKLKRKIDGKREIVFTFPSDYILHPVQTVKIFARGNGVA-NPPEVLVFEGD 546

  Fly   555 KKWPVANSMRSVLANADKEVR 575
            ..:....:::::|.|...|.|
 Worm   547 DTFGAGANVQTILYNNSGEER 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 98/366 (27%)
ATP-synt_B <67..>142 CDD:304375 20/75 (27%)
MreC <178..>224 CDD:302802 17/46 (37%)
LTD 473..574 CDD:279300 31/105 (30%)
ifa-3NP_510649.3 Filament 71..419 CDD:278467 98/396 (25%)
DUF342 <140..209 CDD:302792 16/77 (21%)
DUF904 181..245 CDD:283624 22/70 (31%)
LTD 462..570 CDD:279300 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7818
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128723
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.680

Return to query results.
Submit another query.