DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and mua-6

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_510648.1 Gene:mua-6 WormBaseID:WBGene00003485 Length:581 Species:Caenorhabditis elegans

Alignment Length:592 Identity:160/593 (27%)
Similarity:282/593 (48%) Gaps:79/593 (13%)


  Fly    11 RVSRASTSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLT 75
            ||.:..|.|.....|:.......:..|..|.:|::||:|:..||||||.||:::|.|:.:|.:|.
 Worm    36 RVLKIVTETHSSSVSSGLSPYGQNAASTIRDNREREKKEIMELNDRLASYIEKVRFLDAQNRKLD 100

  Fly    76 QELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTK 140
            .:|.:.|....:.|.::|.:||.|:..|..::.:|.|:..:.|.:|::|.::.|:|:    ||.:
 Worm   101 ADLKMLQGRFGKSTGSVKVMYEMEITTATNVVKQTGKDHGETEKEIRKLQDQLDELR----KKFE 161

  Fly   141 EATVAENNARL--------YENRYNEVNGKYNQSLADRK--KFEDQAKELALENERLRRQLDDLR 195
            ||.......||        ..|...|:|      |..|:  ..|::...|..||.||..:|..:|
 Worm   162 EAQRGRAEDRLKIDDLLVTLSNLEAEIN------LLKRRIALLEEEVARLKKENFRLTSELQRVR 220

  Fly   196 KQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIE-ISEIDGRLSRQY-EAKLQQ 258
            .:|:.|||.|:|.:|:.:::.||:.|..:....||.|.:::...: .||     :|:| :.:|..
 Worm   221 IELDQETLLRIDNQNKVKTILEEIDFMKRGFETELKELQAQAARDTTSE-----NREYFKNELAN 280

  Fly   259 SLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQN 323
            :::::|.:|:..|..||.::|..|...:|.:...:||....:....|||:.:|.:...|..||.:
 Worm   281 AMRDIRAEYDQIMNGNRNDMESWYQLRVQEINTQSNRQNAENNYQKEEVKRLRNQTSELRQKLSD 345

  Fly   324 LEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEI 388
            ||..|..|..:|.:|...|:.:::.:...:...:|:::::|:|....:.|.|.|:|.|.:||.|:
 Worm   346 LESRNLLLEKQIEDLNYQLEDDQRSYEAALNDKDAQIRKLREECQALMVELQMLLDTKQTLDGEL 410

  Fly   389 AAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVK 453
            ..|.::|.|                   :|.|                :|.|.....:..:||:.
 Worm   411 KVYRQMLEG-------------------NSEG----------------NGLRQLVEKVVRTSAIN 440

  Fly   454 RR------RTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHN--KGTEEINLTGWQLT 510
            ..      |.|..|...||    |...:|||::.|.|...||:|:.|.|  :..|| .|..|:|.
 Worm   441 EEADTETMRVVKGEHSSRT----SYQRSAKGNVAIKETSPEGKFVILENTHRAKEE-PLGDWKLK 500

  Fly   511 R-IAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK--KKWPVANSMRSVLANADK 572
            | |.|..|:.|.|.....:....||.|::...|.| :||..|:.:  :.:.|..:::::|.|...
 Worm   501 RKIDGKREIVFTFPSDYILHPFQSVKIFARGQGIA-NPPEVLIFEGDETFGVGANVQTILYNNKG 564

  Fly   573 EVRVLSI 579
            |.|...|
 Worm   565 EERATHI 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 105/368 (29%)
ATP-synt_B <67..>142 CDD:304375 21/75 (28%)
MreC <178..>224 CDD:302802 17/46 (37%)
LTD 473..574 CDD:279300 33/106 (31%)
mua-6NP_510648.1 Filament 71..419 CDD:278467 104/363 (29%)
Uso1_p115_C <141..203 CDD:282695 17/72 (24%)
FAM76 <176..263 CDD:292665 26/93 (28%)
LTD 462..570 CDD:279300 34/110 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7818
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128723
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.