DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and IFFO2

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001129737.1 Gene:IFFO2 HGNCID:27006 Length:517 Species:Homo sapiens

Alignment Length:492 Identity:92/493 (19%)
Similarity:171/493 (35%) Gaps:121/493 (25%)


  Fly    22 GGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVN 86
            ||....:..|.:..|:..|.........|:.||.|..|::.::..||..|..|.::|...|....
Human    29 GGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERE 93

  Fly    87 RETSNLKAVYEKELAAARKLLDETA---------------------------------KEKAKLE 118
            |.........|:.:....:||...|                                 :...:|.
Human    94 RRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLP 158

  Fly   119 ------IDIKRL--------------WEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKY 163
                  ..::|.              |...|.:..::|..|.|.....|.....:...:|...::
Human   159 GTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRW 223

  Fly   164 NQSLADRKKFE---DQAKELALENERLRRQLDDLRKQLEAE----------TLARVDLENQNQSL 215
            .:.||.|...:   |..:|.|.|.:.::.::::..::|:||          .:..:|.:.|.:::
Human   224 EEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAM 288

  Fly   216 REELAFKDQVH-TQELTETRSRRQIE----------------------ISEIDGRLSRQYEAKLQ 257
            :.::....::. |.:|.:...:|..|                      |||.||.::|       
Human   289 KVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNR------- 346

  Fly   258 QSLQELRDQYEGQMRINREEIELL--------YDNEIQNLKAAANRAAQGSALATEEVRLMRTKI 314
                 ..|...|.|.|..|...:.        :|::..:|....|   :.:.|..|:.......|
Human   347 -----FSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEEN---EDTLLLWEDFTNCNPTI 403

  Fly   315 DGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMD 379
            |     ||..::.|.|  ..|.|.|:...|..:.:.:.|..:|.||...:.:|...|.||..:..
Human   404 D-----LQGEQEENLG--NLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCS 461

  Fly   380 IKVSLDLEIAAYDKLLCGEERRLNIESPGR-PTTDSG 415
            :|..||:::....:|:.|...| |..||.. .::|||
Human   462 MKRGLDVQMETCRRLIKGSADR-NSPSPSSVASSDSG 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 80/453 (18%)
ATP-synt_B <67..>142 CDD:304375 18/128 (14%)
MreC <178..>224 CDD:302802 8/56 (14%)
LTD 473..574 CDD:279300
IFFO2NP_001129737.1 Filament 194..483 CDD:278467 60/311 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.