DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LamC and lmnb2

Sequence 1:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002940085.1 Gene:lmnb2 XenbaseID:XB-GENE-490443 Length:623 Species:Xenopus tropicalis

Alignment Length:580 Identity:216/581 (37%)
Similarity:337/581 (58%) Gaps:27/581 (5%)


  Fly    16 STSTPVGGASTSSRV---GATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQE 77
            :|:||....::|.:.   |.::|.||||.||.||||||:|||||||.||||:|:||.||.||..:
 Frog     2 ATATPSRSGTSSMQSPARGTSTPLSPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVK 66

  Fly    78 LNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEA 142
            ::..::...||.|.:|.:||.|||.|||:|||||:|:|:|:|::.:...:.|:|.....||..:.
 Frog    67 ISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADL 131

  Fly   143 TVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVD 207
            :.|:...|..|..::....:...:|.:::..|.:..:|..:..:........:||||.|||.|||
 Frog   132 STAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETLMRVD 196

  Fly   208 LENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMR 272
            .||:.|||:||:.|:..::.:|..|||.|.:..|.|:|......|::||.|:|.|||.|::.|::
 Frog   197 FENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVK 261

  Fly   273 INREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRE 337
            :.:||:|..|..::.|:|.:::...:.:..|.||:...|.:|:.|:.:|..|:........||||
 Frog   262 MYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRE 326

  Fly   338 LENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRL 402
            ||.||.::|.::.:.:.|.|.|:..|||:|..||.|||.|:|:|::||:||.||.|||.|||.||
 Frog   327 LEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQLTEYQELLDVKLALDMEINAYRKLLEGEEERL 391

  Fly   403 NIE-SPGRPTTDSGISSNGSHLTASASSRSGRV--------TPSGRRSATP-GIS------GSSA 451
            .:. ||....|.|..:|:.|..|.::.|:..||        ..:|..:.|. |:|      ||| 
 Frog   392 KLSPSPQSRVTVSRATSSSSSATRTSRSKRKRVEEEYEEGGAGTGLHTGTSLGLSHITASEGSS- 455

  Fly   452 VKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTR-IAGD 515
                |||.......|....|..|:|.|.:.|.|.|:||:::.|.|...::.:|..|:|.| |..:
 Frog   456 ----RTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKIGEE 516

  Fly   516 EELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMKKK--WPVANSMRSVLANADKE 573
            ||:.:||:....:..|.||.|:|.|||.||.||:.||.|.:  |...:::|:.|.|.::|
 Frog   517 EEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEE 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 141/356 (40%)
ATP-synt_B <67..>142 CDD:304375 31/75 (41%)
MreC <178..>224 CDD:302802 19/46 (41%)
LTD 473..574 CDD:279300 39/105 (37%)
lmnb2XP_002940085.1 Filament 34..390 CDD:278467 141/356 (40%)
PCRF 326..>395 CDD:305100 35/69 (51%)
LTD 473..582 CDD:279300 39/105 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7818
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D204815at33208
OrthoFinder 1 1.000 FOG0000811
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.880

Return to query results.
Submit another query.