DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sin1 and MAPKAP1

Sequence 1:NP_610963.1 Gene:Sin1 FlyBaseID:FBgn0033935 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001006618.1 Gene:MAPKAP1 HGNCID:18752 Length:522 Species:Homo sapiens

Alignment Length:622 Identity:163/623 (26%)
Similarity:267/623 (43%) Gaps:171/623 (27%)


  Fly     1 MATYSNQHWLLSHIRNSFISTDDTGMCETVMLSDDMPKHYLRKFGNSGAGGDHYHWRRAHKTPPT 65
            ||...|...:|:|||.|.:::|||||||.|::..|:.   |.|.......||            :
Human     1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVD---LEKIHPPSMPGD------------S 50

  Fly    66 GGGTTPERNTRHPDAPLQEVDFICYPGLDLSDDEEDMSTHSFDIQMYPEVGAHRFRSNTAQKLEK 130
            |................|.||.                |.|:|..:       |.||||||:||:
Human    51 GSEIQGSNGETQGYVYAQSVDI----------------TSSWDFGI-------RRRSNTAQRLER 92

  Fly   131 LDIAKRRAARIKSVNYQE---EVQPPESDDFFKRKELPLSKAERVKNEPKANDDDLSDEGVQSQL 192
            |...::...:.|::.::|   :....|....|::|.|        |.:|..:       |.||.|
Human    93 LRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSL--------KEKPPIS-------GKQSIL 142

  Fly   193 TEQLAKSPKQAQNRFIEFARFDGTSQVG-MQTKRINVFLNMLPEPDRNYPLKICVVATAKIQEVI 256
            :.:|.:.|.|..|.|.|:::|||...|| ..||:|:|:|.:....||..|:.:..:|:|::|::|
Human   143 SVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLI 207

  Fly   257 GFVCYRTSLQYPDVPLK-SLQHYALYMTEDNDDME-DFPPLDNREPCSKFGFSQLTLAERRPLAP 319
            |.:|::.:.:..:..|. ::..|.|::.||:.::: ||||||:.||..|||||.|.|.|:     
Human   208 GLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEK----- 267

  Fly   320 VTRVDYHSQ-LGSK-------------SMTSVED-KTALSDAAVKALQNISLNGGTSDP------ 363
                 |.|. |.||             |:..|:: |..:.:..:||::....:...|.|      
Human   268 -----YSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEK 327

  Fly   364 ---GGGGGGGDSPHDNVKEYEKRLLNHN--------------------DMLEAPMHRTFRLNIID 405
               .......||..::...:|..|:..|                    |||.:..:::|::::|.
Human   328 QSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIH 392

  Fly   406 KRFFKSDVTLGISGERIEIDQCKN----AKFWPQKKPVSTPIDFVAHCEILERRHLKALLRIWLK 466
            :..|.:||.|||||:::|||...|    .|||.::||:|...|.:..|::.|.:           
Human   393 RLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEK----------- 446

  Fly   467 SNSSSPSFSTGCTSAPINASVTTLNAGSGSGGIAHSPSSPGHSSGLFS---SSNIRFKHYDFDTD 528
                                                  ||.|:  :|.   .||..:||..|::|
Human   447 --------------------------------------SPSHA--IFKLTYLSNHDYKHLYFESD 471

  Fly   529 THTAEQIHNKLNCILEMRSSDLRREFLLQRDRKQEKR 565
            ..|..:|..|:|.|||.|:|..|.::..|:.||..:|
Human   472 AATVNEIVLKVNYILESRASTARADYFAQKQRKLNRR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sin1NP_610963.1 SIN1 18..164 CDD:283156 35/149 (23%)
CRIM 189..316 CDD:293583 49/130 (38%)
SIN1_PH 394..545 CDD:293584 40/158 (25%)
MAPKAP1NP_001006618.1 Interaction with NBN. {ECO:0000269|PubMed:23762398} 2..267 95/318 (30%)
Interaction with MAP3K2. {ECO:0000269|PubMed:15988011} 2..184 65/235 (28%)
SIN1 18..129 CDD:310193 35/149 (23%)
CRIM 139..266 CDD:319047 48/127 (38%)
PH_Avo1 383..490 CDD:270139 41/158 (26%)
Interaction with ATF2. {ECO:0000269|PubMed:17054722} 468..522 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140583801
eggNOG 1 0.900 E1_KOG3739
Hieranoid 1 1.000
Homologene 1 1.000 H11473
Inparanoid 1 1.050 170 1.000 Inparanoid score I4069
Isobase 1 0.950 0 Normalized mean entropy S6782
OMA 1 1.010
OrthoDB 1 1.010 D1492466at2759
OrthoFinder 1 1.000 FOG0003784
OrthoInspector 1 1.000 T1073644
orthoMCL 1 0.900 OOG5_134948
Panther 1 1.100 LDO PTHR13335
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1337
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.