DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sin1 and Mapkap1

Sequence 1:NP_610963.1 Gene:Sin1 FlyBaseID:FBgn0033935 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001277554.1 Gene:Mapkap1 MGIID:2444554 Length:522 Species:Mus musculus

Alignment Length:620 Identity:162/621 (26%)
Similarity:272/621 (44%) Gaps:167/621 (27%)


  Fly     1 MATYSNQHWLLSHIRNSFISTDDTGMCETVMLSDDMPKHYLRKFGNSGAGGDHYHWRRAHKTPPT 65
            ||...|...:|:|||.|.:::|||||||.|::..|:.   |.|.......||     ...:...:
Mouse     1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVD---LEKTHPPSVPGD-----SGSEVQGS 57

  Fly    66 GGGTTPERNTRHPDAPLQEVDFICYPGLDLSDDEEDMSTHSFDIQMYPEVGAHRFRSNTAQKLEK 130
            .|.|.               .:|....:|:        |.|:|..:       |.||||||:||:
Mouse    58 SGETQ---------------GYIYAQSVDI--------TSSWDFGI-------RRRSNTAQRLER 92

  Fly   131 LDIAKRRAARIKSVNYQE---EVQPPESDDFFKRKELPLSKAERVKNEPKANDDDLSDEGVQSQL 192
            |...::...:.|::.::|   :....|....|::|.|        |.:|.::       |.||.|
Mouse    93 LRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSL--------KEKPPSS-------GKQSIL 142

  Fly   193 TEQLAKSPKQAQNRFIEFARFDGTSQVG-MQTKRINVFLNMLPEPDRNYPLKICVVATAKIQEVI 256
            :.:|.:.|.|..|.|.|:::|||...|| ..||:|:|:|.:....||..|:.:..:|:|::|::|
Mouse   143 SVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLI 207

  Fly   257 GFVCYRTSLQYPDVPLK-SLQHYALYMTEDNDDME-DFPPLDNREPCSKFGFSQLTLAERRPLAP 319
            |.:|::.:.:..:..|. ::..|.|::.||:.::: ||||||:.||..|||||.|.|.|:     
Mouse   208 GLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEK----- 267

  Fly   320 VTRVDYHSQ-LGSK-------------SMTSVED-KTALSDAAVKALQNISLNGGTSDPGGGGGG 369
                 |.|. |.||             |:..|:: |..:.:..:||::....:...|.|......
Mouse   268 -----YSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEK 327

  Fly   370 GDSPH---------DNVKEYEKRLLNHN--------------------DMLEAPMHRTFRLNIID 405
            ...|:         ::...:|..|:..|                    |||.:..:::|::::|.
Mouse   328 QSEPNIAVDLESTLESQNAWEFCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIH 392

  Fly   406 KRFFKSDVTLGISGERIEIDQCKN----AKFWPQKKPVSTPIDFVAHCEILERRHLKALLRIWLK 466
            :..|.:||.|||||:::|||...|    .|||.::||:|...|.:..|::.|.:           
Mouse   393 RLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCACDLAEEK----------- 446

  Fly   467 SNSSSPSFSTGCTSAPINASVTTLNAGSGSGGIAHSPSSPGHS-SGLFSSSNIRFKHYDFDTDTH 530
                                                  ||.|: ..|...|:..:||..|::|..
Mouse   447 --------------------------------------SPSHAVFKLTYLSSHDYKHLYFESDAA 473

  Fly   531 TAEQIHNKLNCILEMRSSDLRREFLLQRDRKQEKR 565
            |..:|..|:|.|||.|:|..|.::|.|:.||..:|
Mouse   474 TVSEIVLKVNYILESRASTARADYLAQKQRKLNRR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sin1NP_610963.1 SIN1 18..164 CDD:283156 35/149 (23%)
CRIM 189..316 CDD:293583 49/130 (38%)
SIN1_PH 394..545 CDD:293584 39/156 (25%)
Mapkap1NP_001277554.1 Interaction with NBN. {ECO:0000250} 2..267 95/318 (30%)
Interaction with MAP3K2. {ECO:0000250} 2..184 65/235 (28%)
SIN1 18..129 CDD:310193 35/149 (23%)
CRIM 139..266 CDD:319047 48/127 (38%)
PH_Avo1 383..490 CDD:270139 40/156 (26%)
Interaction with ATF2. {ECO:0000250} 468..522 17/42 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140586466
eggNOG 1 0.900 E1_KOG3739
Hieranoid 1 1.000
Homologene 1 1.000 H11473
Inparanoid 1 1.050 173 1.000 Inparanoid score I4054
Isobase 1 0.950 0 Normalized mean entropy S6782
OMA 1 1.010
OrthoDB 1 1.010 D1492466at2759
OrthoFinder 1 1.000 FOG0003784
OrthoInspector 1 1.000 T1083729
orthoMCL 1 0.900 OOG5_134948
Panther 1 1.100 LDO PTHR13335
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1337
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.