DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sin1 and sinh-1

Sequence 1:NP_610963.1 Gene:Sin1 FlyBaseID:FBgn0033935 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_496596.3 Gene:sinh-1 WormBaseID:WBGene00013261 Length:642 Species:Caenorhabditis elegans

Alignment Length:599 Identity:125/600 (21%)
Similarity:209/600 (35%) Gaps:171/600 (29%)


  Fly    10 LLSHIRNSFISTDD--TGMCETVMLSDDMPKHYLRKFGNSGAGGDHYHWRRAHKTPPTGGGTTPE 72
            ||:.||:.....||  .|:|..::|:                                     |:
 Worm     9 LLNVIRHELRLEDDDGPGLCSRLLLN-------------------------------------PD 36

  Fly    73 RNTRHPDAPLQEVDFICYPGLDLSDDEEDMSTHSFDIQMYPEVGAHRFRSNTAQKLEKLDIAKRR 137
            |..|....||   ||....| ||.||.:......::|.:|.|....|...|.:       :|.|.
 Worm    37 RKCRAGGLPL---DFRLKNG-DLMDDGDAGFDDIYEIPLYEEPIHTRTLINDS-------LALRT 90

  Fly   138 AARIKSVNYQEEVQPPESDDFFKRKELPLSKAERVKNEPKANDDDLSDEGVQSQLTEQLAKSPKQ 202
            |.:||....::.......|:.|.::|        |...||.   .:|.|  :|.:...|.::...
 Worm    91 AEKIKEEGRRDNFYTGPLDELFVKQE--------VNWPPKT---PISTE--KSAIERYLEENSAN 142

  Fly   203 AQNRFIEFARFDGTSQVGMQTKRINVFLNMLPEPDRNY-PLKICVVATAKIQEVIGFVCYRTSLQ 266
            ..|...|:::|..|:.  ..:::|.:.:.|..:.:..: .|||.|:.||:|:||||:...:..|.
 Worm   143 LNNPLGEYSKFAATTT--DPSRQIEIIIPMSCDEEIGFKTLKIEVLTTARIREVIGYCLLQYYLT 205

  Fly   267 YPDVPLKSLQHYALYMTEDNDDME-DFPPLDNREPCSKFGFSQLTLAERRPLAPVTRVDYHSQLG 330
            :.......:..|..|:.|::.::| :.||||:.:...:.||:.|.|        |:|:..:....
 Worm   206 FDSYLPGEVDDYQFYLAEEDGEIEHELPPLDSSKLVGQVGFTCLGL--------VSRIKKNGNSR 262

  Fly   331 SKSMTSV--EDKTALSDAAVKALQNISLNGGTSDPGGGGGGGDSP------------HDNVKEYE 381
            .|...:|  .||    |..|..:.|:                :.|            .:.|||.|
 Worm   263 QKRAVAVWFVDK----DQYVIEVDNM----------------EKPLRWLRDEAFRLREETVKERE 307

  Fly   382 KRLLNHNDMLEAPMHRTFRLNIIDKRFFKSDVTLGISGER-IEI----DQCKNAKFWPQKKPVST 441
            .......|:.|      :.:..:|....|.|:...||..| :|.    .....|.|.|:..... 
 Worm   308 PLFQGLLDIKE------YYMEAVDNFDVKLDLEASISSARSLEFVMIRKNSSRAGFHPRGGRYG- 365

  Fly   442 PIDFVAHCEILERRHLKALLRIWLKSNSSSPSFSTGCTSAPINASVTTLNAGSGS---------- 496
                         |.:.|:|.:.:   .:||..:...|..|.....:...||:.:          
 Worm   366 -------------RQMSAMLTLKM---PNSPIAAGPMTPLPTVMEESPAVAGTSNGFGFPKAESC 414

  Fly   497 GGIAHSPSSPGHSSGLFSSSNIRFKHYDFDTDTHTAEQIHN-----KLNCILEMRSSDL------ 550
            |.||.:|....:..|...||.|             .::||.     |.|.|......::      
 Worm   415 GAIASTPGVTWNDDGGQLSSFI-------------VQRIHKFKPKWKANLIFRWTCFEIEKYRED 466

  Fly   551 RREFLLQRDRKQEK 564
            |..||.|..:|..|
 Worm   467 RSAFLPQGYQKHTK 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sin1NP_610963.1 SIN1 18..164 CDD:283156 30/148 (20%)
CRIM 189..316 CDD:293583 32/129 (25%)
SIN1_PH 394..545 CDD:293584 32/171 (19%)
sinh-1NP_496596.3 SIN1 18..117 CDD:283156 30/155 (19%)
CRIM 129..263 CDD:293583 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140075988
eggNOG 1 0.900 E1_KOG3739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6782
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003784
OrthoInspector 1 1.000 T474378
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13335
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1337
TreeFam 1 0.960
87.870

Return to query results.
Submit another query.