DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sin1 and mapkap1

Sequence 1:NP_610963.1 Gene:Sin1 FlyBaseID:FBgn0033935 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001093676.1 Gene:mapkap1 XenbaseID:XB-GENE-478752 Length:520 Species:Xenopus tropicalis

Alignment Length:624 Identity:164/625 (26%)
Similarity:269/625 (43%) Gaps:175/625 (28%)


  Fly     1 MATYSNQHWLLSHIRNSFISTDDTGMCETVMLSDDMPKHYLRKFGNSGAGGDHYHWRRAHKTPPT 65
            ||...|...:|:|||.|.:::|||||||.|::..|:.   |.|...|...|::....:::     
 Frog     1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVD---LEKLYQSSVSGENSTQMQSN----- 57

  Fly    66 GGGTTPERNTRHPDAPLQEVDFICYPGLDLSDDEEDMSTHSFDIQMYPEVGAHRFRSNTAQKLEK 130
             ||.|.              .::....:|:        |.|:|..:       |.|||||||||:
 Frog    58 -GGETQ--------------GYVYSQSVDI--------TSSWDFGI-------RRRSNTAQKLER 92

  Fly   131 LDIAKRRAARIKSVNYQE---EVQPPESDDFFKRKELPLSKAERVKNEPKANDDDLSDEGVQSQL 192
            |...::...:.|:|.:::   .....|....|:||..    .||..|           :|.||.|
 Frog    93 LRKERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNF----KERALN-----------QGKQSIL 142

  Fly   193 TEQLAKSPKQAQNRFIEFARFDGTSQVG-MQTKRINVFLNMLPEPDRNYPLKICVVATAKIQEVI 256
            :.:|.:.|.|..|.|.|:::|||...|| ..||:|:|:|:|....|:..|:.:..:|.||:.::|
 Frog   143 SVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLSMQTSQDKLLPMTVVTIANAKVHDLI 207

  Fly   257 GFVCYRTSLQYPDVPLK-SLQHYALYMTEDNDDME-DFPPLDNREPCSKFGFSQLTLAERRPLAP 319
            |.:|::.:.:..:..|. ::..:.|::.||:.::: ||||||:.||..|||||.|.|.|:     
 Frog   208 GLICWQYTTEGREPKLNDNVDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEK----- 267

  Fly   320 VTRVDYHSQ-LGSKSMTSVE------------DKTALS-----DAAVKALQNISLNGG------- 359
                 |.|. |.:|....|.            |.|.::     :.|:|..:....|.|       
 Frog   268 -----YSSPGLAAKQSLFVRINAAHGFSLIQVDSTNVTMRDILEKALKRRKGSQRNSGPQYRLEK 327

  Fly   360 TSDPG---------------------GGGGGGDSPHDNVKEYEKRLLNHNDMLEAPMHRTFRLNI 403
            .|.|.                     .....|:.|.:  :|.:..:....|||.:..:::|::::
 Frog   328 QSQPNVPVDLDSTLENQNSLEFCLVRENSSRGEEPPE--EETQIDIATVQDMLSSHQYKSFKVSM 390

  Fly   404 IDKRFFKSDVTLGISGERIEIDQCKN----AKFWPQKKPVSTPIDFVAHCEILERRHLKALLRIW 464
            |.:..|.:||.||||||::|||...|    .|||.::||:|...|.:..|::.|.:         
 Frog   391 IHRLRFTTDVQLGISGEKVEIDPVTNQKTSTKFWIKQKPISIDSDVLCACDLAEEK--------- 446

  Fly   465 LKSNSSSPSFSTGCTSAPINASVTTLNAGSGSGGIAHSPSSPGHSSGLFS---SSNIRFKHYDFD 526
                                                    ||.|:  :|.   .||..:||..|:
 Frog   447 ----------------------------------------SPSHA--MFKVTYLSNHDYKHLYFE 469

  Fly   527 TDTHTAEQIHNKLNCILEMRSSDLRREFLLQRDRKQEKR 565
            :|..|..:|..|:|.|||.|:|..|.::..|:.||..:|
 Frog   470 SDAATVNEIVLKVNYILESRASTARADYFAQKQRKLTRR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sin1NP_610963.1 SIN1 18..164 CDD:283156 37/149 (25%)
CRIM 189..316 CDD:293583 48/130 (37%)
SIN1_PH 394..545 CDD:293584 41/158 (26%)
mapkap1NP_001093676.1 SIN1 18..129 CDD:283156 37/149 (25%)
CRIM 139..266 CDD:293583 47/127 (37%)
PH_Avo1 383..490 CDD:270139 42/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140585950
eggNOG 1 0.900 E1_KOG3739
Hieranoid 1 1.000
Homologene 1 1.000 H11473
Inparanoid 1 1.050 178 1.000 Inparanoid score I3817
OMA 1 1.010
OrthoDB 1 1.010 D1492466at2759
OrthoFinder 1 1.000 FOG0003784
OrthoInspector 1 1.000 T1059720
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1337
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.