DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb1 and TFB1

Sequence 1:NP_001246321.1 Gene:Tfb1 FlyBaseID:FBgn0033929 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_010597.3 Gene:TFB1 SGDID:S000002719 Length:642 Species:Saccharomyces cerevisiae

Alignment Length:627 Identity:133/628 (21%)
Similarity:239/628 (38%) Gaps:138/628 (22%)


  Fly     3 TSSEDVLLQMGEV--RYKKGDGTLYVMNERVAWMAEHRDTVTVSHRYADIKTQKISPEGKPKVQL 65
            |..:::.:.:.::  |||  |..:|....|....|:|.:|                |.....|  
Yeast    95 TVMDNIKMTLQQIISRYK--DADIYEEKRRREESAQHTET----------------PMSSSSV-- 139

  Fly    66 QVVLHDGNTSTFHFVNRQ-GQAAMLADRDKVKELLQQLLPNFKRKVDKDLEDKNRILVENPNLLQ 129
                 ...|.|.|....| ...|.|.:..|:.:.|.      |.|:..:|:.:..:|..|..|::
Yeast   140 -----TAGTPTPHLDTPQLNNGAPLINTAKLDDSLS------KEKLLTNLKLQQSLLKGNKVLMK 193

  Fly   130 LYKDLVITKVLTSDEFWATHAKDHALKKMGRSQEIGVSGAFLADIKPQTDGCNGLKYNLTSDVIH 194
            ::::.||...|...|||:|.........:..||::|.... |:.|||.....|.:..||:.:.|.
Yeast   194 VFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNV-LSTIKPVASSENKVNVNLSREKIL 257

  Fly   195 CIFKTYPAVKRKHFENVPAKMSEAEFWTKFFQSHYFHRDRLTAGTKDIFTECGKI---------- 249
            .||:.||.||:.:.:|||....|.|||.:||.|..|.:.|   |.|.:..:.|.:          
Yeast   258 NIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLR---GEKIMQNDRGDVIIDRYLTLDQ 319

  Fly   250 -----DDQALKAAVQQGAGDPLLDLK-KFEDVPLEEG-------------FGSVAGDRNVVNSGN 295
                 ||..|...|::     ::||. ..:|.|:..|             .|:..|..:::...|
Yeast   320 EFDRKDDDMLLHPVKK-----IIDLDGNIQDDPVVRGNRPDFTMQPGVDINGNSDGTVDILKGMN 379

  Fly   296 IVHQNMIKRF-NQHSIMVLKTCANVTSAPSTMTNGTNN--ANGPVSQSAYTN------GMNGKGQ 351
            .:.:.||... |::|...|:..:|:|:......|...|  ....:::|..||      ..|...:
Yeast   380 RLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELKIDDLNESYKTNYAIIHLKRNAHEK 444

  Fly   352 ATATATKSSSDQVDKDEPQSKKQRLMEKIHYVDLGDPILEGDDSANGEKAKSKHFELSKVERYLN 416
            .|....|||:|.:...:.:...|::::::..|        .|:..|            |::  ||
Yeast   445 TTDNDAKSSADSIKNADLKVSNQQMLQQLSLV--------MDNLIN------------KLD--LN 487

  Fly   417 GPVQNSMYDNHNDPMSLEEVQYKLVRNSESWLNRNVQRTFICSKAAVNALGELSPGGSMMRGFQE 481
            ..|.|:...|..:...:..::.    |::...:.||.          :|||......|.....:.
Yeast   488 QVVPNNEVSNKINKRVITAIKI----NAKQAKHNNVN----------SALGSFVDNTSQANELEV 538

  Fly   482 QSAGQLVPNDFQRELRHLYLSLSELLKHFWSCFPPTSEE-----------LETKLQRMHETLQRF 535
            :|.   :|.|.....|.|:.:..|.||||:..|....::           |:..:::::|..|..
Yeast   539 KST---LPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDV 600

  Fly   536 KMAKLVPFENRAMHELSPLRSSLT-------QHLNQLLRTAN 570
            .........|.....|.|:.:|:|       ::.|:....:|
Yeast   601 LNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb1NP_001246321.1 PH_TFIIH 10..104 CDD:270049 19/97 (20%)
BSD 104..157 CDD:128990 13/53 (25%)
BSD 181..234 CDD:281847 21/53 (40%)
TFB1NP_010597.3 PH_TFIIH 9..105 CDD:312167 1/10 (10%)
BSD 170..221 CDD:128990 13/57 (23%)
BSD 245..295 CDD:128990 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282671047
eggNOG 1 0.900 E1_KOG2074
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1584
Isobase 1 0.950 0.928771 Normalized mean entropy S3315
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004045
OrthoInspector 1 1.000 T1136093
orthoMCL 1 0.900 OOG5_129968
Panther 1 1.100 LDO PTHR12856
Phylome 1 0.910 0.917 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1500
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.