DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tfb1 and gtf2h1

Sequence 1:NP_001246321.1 Gene:Tfb1 FlyBaseID:FBgn0033929 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_012809948.1 Gene:gtf2h1 XenbaseID:XB-GENE-975300 Length:556 Species:Xenopus tropicalis

Alignment Length:591 Identity:270/592 (46%)
Similarity:374/592 (63%) Gaps:58/592 (10%)


  Fly     1 MTTSSEDVLLQMGEVRYKKGDGTLYVMNERVAWMAEHRDTVTVSHRYADIKTQKISPEGKPKVQL 65
            |.||||:|||.:.:||:||.||.||:|.|||||..|.:|..|:||.|||||.|||||:||.||||
 Frog    10 MATSSEEVLLIVKKVRHKKQDGALYLMAERVAWAPEGKDRFTISHMYADIKCQKISPDGKAKVQL 74

  Fly    66 QVVLHDGNTSTFHFVNRQGQAAMLADRDKVKELLQQLLPNFKRKVDKDLEDKNRILVENPNLLQL 130
            |:|||.|.|:.|||.|   .|..:.:||.||||||||||.||||.:|:||:|||:|.|:|.|.||
 Frog    75 QLVLHVGETTNFHFSN---DATAIKERDAVKELLQQLLPKFKRKANKELEEKNRMLKEDPVLFQL 136

  Fly   131 YKDLVITKVLTSDEFWATHAKDHALKK--MGRSQEIGVSGAFLADIKPQTDGCNGLKYNLTSDVI 193
            |||||:::|::::||||.....::|..  :...|::|:|.|||||::|||||||||:||||||:|
 Frog   137 YKDLVVSQVISAEEFWANRLSLNSLDSSVLASKQDVGISAAFLADVRPQTDGCNGLRYNLTSDII 201

  Fly   194 HCIFKTYPAVKRKHFENVPAKMSEAEFWTKFFQSHYFHRDRLTAGTKDIFTECGKIDDQALKAAV 258
            ..||:||||||.|:.||||..|:|.:||.:||||||||||||..|.||:|.||.|:|::.||:.|
 Frog   202 ESIFRTYPAVKLKYAENVPHNMTEKDFWKQFFQSHYFHRDRLNTGAKDLFAECAKMDERGLKSMV 266

  Fly   259 QQGAGDPLLDLKKFEDVPLEEGFG-----SVAGDRNVVNSGNIVHQNMIKRFNQHSIMVLKTCAN 318
            .||..:|:|||...||..||||:|     |.:..:::..:.|..   :|||||.||.|||.....
 Frog   267 SQGVKNPMLDLMALEDKCLEEGYGISSAPSTSSTKSIKENSNAA---IIKRFNHHSAMVLAAGLR 328

  Fly   319 VTSAPSTMTNGTNNANGPVSQSAYTNGMNGKGQATATATKSSSDQVDKDEPQSKKQRLMEKIHYV 383
            ...|.|...:.|::.:|                        :|...|...|..||.:|.|.|.|.
 Frog   329 KDEAQSDQCSETSSTDG------------------------NSRDSDFFLPPVKKVKLQEAIEYE 369

  Fly   384 DLGDPILEGDDSANGEKAKSKHFELSKVERYLNG--PVQNSMYDNHNDPM-SLEEVQYKLVRNSE 445
            ||        |.:||  .|.....|.|.:||.:|  |:|:..|.:..|.: |:..::.::    |
 Frog   370 DL--------DQSNG--MKPLVLNLKKSDRYYHGPTPIQSQQYASSQDILSSIHSIKQQM----E 420

  Fly   446 SWLNRNVQRTFICSKAAVNALGELSPGGSMMRGFQEQSAGQLVPNDFQRELRHLYLSLSELLKHF 510
            ::..|..|  .:.|.||.:....|:|||::|:|..:|:..||||||.|.||:|||:::.|||:||
 Frog   421 NYTPRLTQ--VLSSGAASSTTAALTPGGALMQGVTQQAINQLVPNDIQSELKHLYVAVGELLRHF 483

  Fly   511 WSCFPPTSEELETKLQRMHETLQRFKMAKLVPFENRAMHELSPLRSSLTQHLNQLLRTANSKFAT 575
            |||||..:..||.|:.:|...|:||::.||.||:.:...:.  |.::||.||.::|:||.:||.|
 Frog   484 WSCFPVNTPFLEEKVMKMKSNLERFQVTKLRPFQEKLRKQY--LGTNLTGHLEEMLQTAYTKFHT 546

  Fly   576 WKERKL 581
            |:.|::
 Frog   547 WQSRRM 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tfb1NP_001246321.1 PH_TFIIH 10..104 CDD:270049 58/94 (62%)
BSD 104..157 CDD:128990 28/53 (53%)
BSD 181..234 CDD:281847 38/53 (72%)
gtf2h1XP_012809948.1 PH_TFIIH 19..111 CDD:270049 59/95 (62%)
BSD 110..163 CDD:128990 28/53 (53%)
BSD 190..240 CDD:128990 35/50 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282656605
eggNOG 1 0.900 E1_KOG2074
Hieranoid 1 1.000
Homologene 1 1.000 H3885
Inparanoid 1 1.050 491 1.000 Inparanoid score I1300
OMA 1 1.010
OrthoDB 1 1.010 D355210at33208
OrthoFinder 1 1.000 FOG0004045
OrthoInspector 1 1.000 T601349
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1500
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.