DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Tdrd7

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_006238169.1 Gene:Tdrd7 RGDID:619724 Length:1146 Species:Rattus norvegicus

Alignment Length:706 Identity:148/707 (21%)
Similarity:265/707 (37%) Gaps:219/707 (31%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTV--TGH 68
            |..||.|::.:::.|....:.:.:|..:|||..|..:|:.:||:...|::|||:|..|.:  :..
  Rat    36 EADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRS 100

  Fly    69 GQMAWITAVATAKSAHIQKLVRCQKKSKNRGSH------------------KPK----------- 104
            |::. ..|||..::|.|.:||..|:.||.:...                  |||           
  Rat   101 GEIV-CYAVACTETARIAQLVARQRTSKRKTGRQINCQMRVKKTMPFFLEGKPKATLRQPGFASD 164

  Fly   105 YCYASEPSNLVFINESVSKMKNRKA-----PFPTYQVPRNLKLPV--------SYPNYNRLLYPV 156
            |..:.:| |...:.|..|.: ..||     |:|...|.|::.:..        |:|..::|.:..
  Rat   165 YSISKKP-NPTLLREKGSTL-GAKADVDMPPYPDAPVQRHVSMSANSSVTVLRSHPEASKLQFMG 227

  Fly   157 HTP--------------------HIDQMISTGQQQSTLRT-QRPSF--PCNANSKSLKVNDWSQK 198
            ::|                    ||.:........:..:| ::|:.  |.:..:|..:|     :
  Rat   228 YSPKPHCLLLFSPKSSLPAPFQTHISRACPKEVNDNLNQTVEKPNVTPPASYTNKMDEV-----Q 287

  Fly   199 DRKQEPSKERNN----QKYPKITTENKQEKETEELAQAFEN----LSVD----------VAPTDH 245
            :|.:|...:.||    .|.|....|..:|...:.:.|.||:    .:|:          :.|...
  Rat   288 NRIKEILDKHNNGIWISKLPHFYKEFYKEDLNQGVLQQFEHWPHICTVEKPCGGGQDLLLYPAKR 352

  Fly   246 QEKLKCEIYEDNEDE-------------FVRDPFIYGEVKEKEDE------------AVVLAFDA 285
            ::.|:.:  :|.|.|             ....|.:..:||||..|            |:..||:.
  Rat   353 EQPLRSD--QDPEKERPPPPPAPRQEVPSKGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFED 415

  Fly   286 VSEDGFDLLSMTTTQQNAVKPLDPPEDCL-HYASSDD--------GEDENAIPAYAVDHRVLDVD 341
            :.:..|                  |||.| :.||..|        |..:.|| .||      .:.
  Rat   416 MYKVKF------------------PEDALKNLASLSDVCTINYISGNTQKAI-LYA------KLP 455

  Fly   342 YPRDAV-------RSAFTLPARDIESIIELQQRIRVQ---------------------------L 372
            .|.|.:       :..|     ||:|:|| |:.::::                           .
  Rat   456 LPTDKILKDEAQAQGDF-----DIKSMIE-QEYLQIEKNMAESADDFVEDITVPPLVIPTEASPS 514

  Fly   373 VSLVNPHNFNFWIYNDDFKDYEAQFANMQTFYESSESKN-YTMPLFLITTDHLCVVRC-TSGWER 435
            |.:|...|.|..:.....|||.|....|:...:...|:| ...|:..:....|..|.. ...|.|
  Rat   515 VLVVELSNTNDVVIRYVGKDYSAAQELMEDEMKEYYSRNPRVTPIQTVHVGQLLAVNAEEDAWLR 579

  Fly   436 AKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAF-ITQCKSPNWT 499
            |:::    |.::..|:|..||.|....:.:.      |.:.|.||.|   .|:| .|:||...  
  Rat   580 AQII----STDENKIKVCYVDYGFCENIEKS------KAYRLNPRFC---SLSFQATKCKLAG-- 629

  Fly   500 AEVVNFFHDMILL--RLLYAKVEAI----KNNTAYLVLVDTESQGHTVNLNRSLIE 549
            .|::|...:::.:  .|...|:.|:    |::...:||.||..: ..:|:|.:.::
  Rat   630 LEILNDDPNLVKVVESLTCGKIFAVEILDKSDIPLVVLYDTSGE-DDININATCLK 684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 27/88 (31%)
TUDOR 379..488 CDD:278965 27/111 (24%)
Tdrd7XP_006238169.1 LOTUS_1_TDRD7 38..124 CDD:193600 27/87 (31%)
LOTUS_2_TDRD7 283..349 CDD:193587 13/71 (18%)
LOTUS_3_TDRD7 388..452 CDD:193588 20/83 (24%)
TUDOR 507..629 CDD:278965 33/135 (24%)
TUDOR 565..607 CDD:119391 11/52 (21%)
TUDOR 696..823 CDD:278965
TUDOR 755..800 CDD:119391
TUDOR 957..1074 CDD:278965
TUDOR 1011..1055 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.