DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and si:dkeyp-93d12.1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001182210.1 Gene:si:dkeyp-93d12.1 ZFINID:ZDB-GENE-041014-303 Length:1883 Species:Danio rerio

Alignment Length:549 Identity:114/550 (21%)
Similarity:181/550 (33%) Gaps:138/550 (25%)


  Fly    92 QKKSKNRGSHKPKYCYASEPSNL---------VFINESVSKMK---------NRKAP----FPTY 134
            ||.|:.:...||     .|..||         |..|.|..:.|         ||..|    |..|
Zfish   418 QKHSEKQAGVKP-----HESDNLRSNSNFPYDVLSNVSAGETKVAQTSDSNPNRAIPDDSFFEGY 477

  Fly   135 QVPRNLKLPVSYPNYNRLLYPVHTPHIDQMI-STGQQQSTLRTQRPSFP--------CNANSKSL 190
            .|      .|..|.:..:....|.|:.:.|. ......|.|:.....|.        |......:
Zfish   478 VV------HVQSPKHFWIRTKEHNPNFENMTKEMADYFSKLQLHEEVFEDLVPGALCCAMYENDM 536

  Fly   191 K-----VNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLK 250
            :     |.|...|..:.......|.:|.|.|..:...:|.......|.|.....|||  |:    
Zfish   537 QYYRALVVDTLDKGAEVFFIDFGNTEKVPGILIKKLPKKFAIHPEFAMECALAHVAP--HE---- 595

  Fly   251 CEIYEDNEDEFVRD-----PFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQ--------- 301
             :|:......:.|:     ..:...|..|..:.||..|:..:|:......|||.:.         
Zfish   596 -DIWTTTASNYFREVTSDKTLMIHVVHRKNRKYVVDLFERDAENCSIATIMTTAKMALDWRYNPA 659

  Fly   302 --------------NAVKPLDPPED----CLHYASSD---------DGEDENAIPAYAVDHRVLD 339
                          ||:......:|    ..|..:|.         :.|.:|.:..:.....:..
Zfish   660 LASVEIERPCKYKGNALSKKKNKKDLRVVTFHKVTSSMSSPNQIEHEWEPQNYLEKHTPSETLKP 724

  Fly   340 VDYPRDAVRSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDFK-DYEAQFANMQTF 403
            ...|...::.....|..::..|           .|.||..: :||..|...| |.:.....||.|
Zfish   725 EVVPAKTLKPMHFKPGSEVSVI-----------CSHVNTPS-DFWCQNVSTKLDLDKLMEEMQLF 777

  Fly   404 YESSESKNYTMPLFLITTDHLCVVRC--TSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQQ 466
            |::     ||..|.:...  .|.|:.  .:.|.||.::|   .:|:..:.: |||:|.||:...|
Zfish   778 YQT-----YTSGLLMPAL--CCAVKSPHDNQWHRACMIG---QHNEQLLMI-LVDVGLIIQEKLQ 831

  Fly   467 NVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMI---------LLRLLYAKVEAI 522
            |::.|...|..||.|....||.||......:|::|..|...|.:         :...:|.|.:.:
Zfish   832 NIQTLQPQFLELPTQAFRCRLNFIEPIGGSSWSSEACNLLRDFLFKCTSSKCRIYSQVYEKGKGL 896

  Fly   523 KNNTAYLVLVDTESQGHTVNLNRSLIETG 551
            .|    :|.:.|..|    ..:..|:|.|
Zfish   897 LN----IVSIHTPLQ----QASTYLVEKG 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 1/1 (100%)
TUDOR 379..488 CDD:278965 34/112 (30%)
si:dkeyp-93d12.1NP_001182210.1 TUDOR 69..113 CDD:119391
TUDOR 264..370 CDD:278965
TUDOR 306..352 CDD:119391
TUDOR 468..590 CDD:278965 23/128 (18%)
TUDOR 525..571 CDD:119391 8/46 (17%)
TUDOR 738..852 CDD:278965 38/137 (28%)
TUDOR 945..1065 CDD:278965
TUDOR 999..1043 CDD:119391
TUDOR 1227..1339 CDD:278965
TUDOR 1274..1319 CDD:119391
TUDOR 1618..1729 CDD:278965
TUDOR 1661..1710 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.