DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tdrd5

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001072763.1 Gene:tdrd5 XenbaseID:XB-GENE-5884032 Length:963 Species:Xenopus tropicalis

Alignment Length:749 Identity:143/750 (19%)
Similarity:248/750 (33%) Gaps:246/750 (33%)


  Fly    10 VKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGHGQM--- 71
            ::|.|.:|:::|...|::.:|.:|||...|..:|...||:|.....|..:|..|.:  |.|:   
 Frog    10 IQKDVRALLIASKNGLSIHELEQDYRMMIGSHIPIRSLGYKSTMELLLDMPSVVKI--HTQLDGT 72

  Fly    72 AWITAVATAKSAHIQKLVRCQK-----KSKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPF 131
            ..::||....:..|..||.|||     :::||..:....|    |.:||        .:.|.:|.
 Frog    73 VKLSAVVDETTRRIADLVSCQKDRCTARTRNRRRNIRPRC----PVDLV--------RRGRVSPV 125

  Fly   132 PTYQVPRNLK--LPVS-----------------------YPNYNRL------------------- 152
            ....|..:|:  |.||                       |..|:.|                   
 Frog   126 LPATVKSDLRDLLSVSPLLLSELEKAFSSRFGRSFQYTRYGFYSMLEVLRSITDIVEVKQTRAGS 190

  Fly   153 ---LYPVHTPHIDQMISTGQQQSTLRTQR-----------PSFPCNANSKS---LKVN--DWSQK 198
               |....|..|...:...|.|..:..::           |..|....|::   |||:  :..:.
 Frog   191 LLVLRNSETGRISASLCVKQSQLAIDPKKTSCVLEQCLKEPRTPEKKTSETVTYLKVSPPEPQKL 255

  Fly   199 DRKQEPSKERNNQKYPKITTENKQE------------KETEELAQAFENLSVDV----------- 240
            ..|:.||..|:..  |.|.:.||::            |..|..|....|.:..|           
 Frog   256 SSKESPSVTRSTS--PLINSSNKEQRLKLNVLLDESLKSNENKAPPVTNFTSAVPSHNSVLSNSL 318

  Fly   241 ---------------APTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVL------AFD 284
                           .||.|.|       .|:......|..:...:::|.::.:.|      |..
 Frog   319 VGNSVSSETLFTKMSRPTSHVE-------ADHSAASEPDASVLEWLEKKLEKELKLCLARKGAGG 376

  Fly   285 AVSE--------------DGFDLLSMTTTQQNAV-KPLDPPE--------------DCLHYASSD 320
            :||:              ||..:..:.|..::.. |.|...|              |.|...|:.
 Frog   377 SVSDALRMDIQHVVNQHSDGLKISQLPTVFKSFTGKDLPFKELGFMSVMELVGSLGDILCVESTV 441

  Fly   321 DGED---------------ENAIPAYA-------------------------VDHRVL------- 338
            ||:|               ...:|:.:                         ||.::.       
 Frog   442 DGKDWKLFDAKKKDLVDEFSAGLPSTSSILSSWNSSQQTTTPVKPVGTIFSKVDEKLWWGPLELK 506

  Fly   339 -----DVDYPRDAVRS--AFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIY-----NDDFK 391
                 .:|.|.||||:  ...||:      ::....|.|.:.::.:|..|    |     .|..:
 Frog   507 LCSTEQIDIPPDAVRNQKLHCLPS------MKRGFMIGVYVENIESPSQF----YVRCCGKDTSE 561

  Fly   392 DYEAQFANMQTFYESSE--SKNYTMPLFLITTDHLCVVRCTSG--WERAKVLGYRSSNNKMTIEV 452
            ..|.....|:..| |:|  |:.|.:....|:...:..:|....  |.|..|   ....|...::|
 Frog   562 KLEDMMIEMRHCY-SNECVSERYIVTDNCISVGQIYALRVPGDVWWYRVIV---HDIKNSELLDV 622

  Fly   453 ELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYA 517
            ...|.|::..|.:..::||...:..:|.|.:...|.::|..:. .|:|:.:..|..:.....|..
 Frog   623 FYPDFGNVATVKKSWLRFLKNCYMKIPAQAVPSSLPYVTSTED-QWSAQAIKKFQQLCSCIPLVG 686

  Fly   518 KVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETG 551
            .|.....:..::.|.||.|: ..:.|::.||..|
 Frog   687 MVLQYVQDILHIFLCDTSSE-EDLYLHQLLISQG 719

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 26/86 (30%)
TUDOR 379..488 CDD:278965 25/118 (21%)
tdrd5NP_001072763.1 LabA_like_C 3..95 CDD:301363 27/87 (31%)
LabA_like_C 127..195 CDD:301363 9/68 (13%)
LOTUS_3_TDRD5 379..452 CDD:193590 13/73 (18%)
TUDOR 531..658 CDD:278965 28/135 (21%)
TUDOR 593..639 CDD:119391 9/49 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I4924
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1115068at2759
OrthoFinder 1 1.000 FOG0005690
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.