DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tdrd6

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_694024.6 Gene:tdrd6 ZFINID:ZDB-GENE-041001-210 Length:2117 Species:Danio rerio

Alignment Length:436 Identity:90/437 (21%)
Similarity:147/437 (34%) Gaps:117/437 (27%)


  Fly   184 NANSKSLKVNDWS--QKDRKQEPSKERNNQKYPKITTENKQEKETEE----LAQAFENLSVDVAP 242
            |.|...:.|..|.  .:|||....:.:...:||:   |...|.:...    |.|.:|..      
Zfish    22 NLNPSCVLVEFWGNFDEDRKFAYQQLKKEIQYPR---ECFSESDGNPGDLCLVQVYETW------ 77

  Fly   243 TDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLA------FDAVSEDGFDLLSMTTTQQ 301
                  .:..|...:.||:  ..|:..|.:........||      |....|..|.:|:      
Zfish    78 ------YRARIVSRDSDEY--SVFLIDEGRTLRAAVNTLAWGKSDFFYLPPEVEFCILA------ 128

  Fly   302 NAVKPLDPPED----CLHYASSDDGEDENA-IPAYAVDHRVLDVDYP------------------ 343
            ||: ||.|..:    .|.:..:..|...|| :....|.||...:|.|                  
Zfish   129 NAL-PLSPENNWSSMALEFMKTFCGRRVNATVQDVLVAHRTFLLDIPCLSRQMFEMGFAKKLYSD 192

  Fly   344 -------RDAVRSAFTLPARDIES-------IIELQQRIR--------------VQLVSLVNPHN 380
                   |....|..|...:.|.|       |||.:::.:              |.:..:.:|..
Zfish   193 QFMEFVVRSLQASTGTSDLKRISSIRTKPVEIIEQKEKQQAYMFPELQTDTVETVVITEVTSPFR 257

  Fly   381 F--NFWIYNDDFKDYEAQFANMQTFYES------SESKNYTMPLFLITTDHLCVVRCTSG-WERA 436
            .  ...:::.:.|....|...   :||.      :.::|...|         |..|.:.| |.|:
Zfish   258 IFCQLKVFSQELKKLTEQITQ---YYEGRVGSYFARAENLGSP---------CASRGSDGKWYRS 310

  Fly   437 KVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAE 501
            .:....|:||  .:||..||.|....|..:|||.|...|..:|.......|..|.. |...|||.
Zfish   311 VLQQVMSANN--VVEVLHVDYGKKQFVQVENVKPLASEFFRMPVVTYVCSLHGIVD-KGVGWTAS 372

  Fly   502 VVNFFHDMILLRLLYAK--VEAIKNNTAYLVLVDTESQGHTVNLNR 545
            .:::...::|.|.:.||  .:::.....|:.|...|:    .|:|:
Zfish   373 QIDYLKSLLLNRTVIAKFQYQSLSEGVHYVTLYGEEN----TNINK 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 27/118 (23%)
tdrd6XP_694024.6 TUDOR 10..129 CDD:278965 25/130 (19%)
TUDOR 66..>100 CDD:119391 8/48 (17%)
TUDOR 247..361 CDD:278965 29/128 (23%)
TUDOR 295..342 CDD:119391 18/58 (31%)
TUDOR 474..595 CDD:278965
TUDOR 531..576 CDD:119391
TUDOR 711..827 CDD:278965
TUDOR 763..808 CDD:119391
TUDOR 929..1044 CDD:278965
TUDOR 978..1022 CDD:119391
TUDOR 1231..1350 CDD:278965
TUDOR 1286..1332 CDD:119391
TUDOR 1434..1554 CDD:278965
TUDOR 1489..1535 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.