DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and Snd1

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_062750.2 Gene:Snd1 / 56463 MGIID:1929266 Length:910 Species:Mus musculus


Alignment Length:410 Identity:75/410 - (18%)
Similarity:141/410 - (34%) Gaps:108/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDGGELSLVKKVVHSLVVSSPGKLTVEQL-----MRDYRSEEGCTLPYSKLGFKDAESFLRSIPD 61
            |..|:....|:.:..|..:...:..||.:     ::.|..:|.|.:.:...|. :.....|::|.
Mouse   506 DISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGI-ECPRGARNLPG 569

  Fly    62 TVTVTGHGQMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNL--VFINESVSKM 124
            .|.   .|:.....|....|...:|:.|..:.:|.::..:...:.: .:.:||  :.:.:::|| 
Mouse   570 LVQ---EGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLH-MDGANLSVLLVEQALSK- 629

  Fly   125 KNRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKS 189
                                           ||        .|.::.:   ..:|.......:|.
Mouse   630 -------------------------------VH--------FTAERSA---YYKPLLSAEEAAKQ 652

  Fly   190 LKVNDWSQ-KDRKQE------PSKERNNQKYPKITTE-------NKQEKET-EELAQAFENLSVD 239
            .|...|:. ::|..|      ..|||:....|...||       ..|:.|| .:|.:..||:..|
Mouse   653 RKEKVWAHYEERPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRND 717

  Fly   240 VA---PTDHQEKLKCEIYEDNEDEFVRDPFIYGE-----VKEKEDEAVVLAFDAVSEDGFDLLSM 296
            ::   |.:..       |.....||....|:.||     |::.|..|.|..| .:.....::|  
Mouse   718 ISSHPPVEGS-------YAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVF-YIDYGNREIL-- 772

  Fly   297 TTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPR--DAVRSAFTLPARDIE 359
            .:|:...:.|               ......:||.|.::....:..|:  ||...|.....|||:
Mouse   773 PSTRLGTLPP---------------AFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQ 822

  Fly   360 SIIELQQRIRVQLVSLVNPH 379
            :   .|..:.|:.:|...||
Mouse   823 N---TQCLLNVEHLSASCPH 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 16/90 (18%)
TUDOR 379..488 CDD:278965 1/1 (100%)
Snd1NP_062750.2 SNc 21..166 CDD:214615
SNc 26..166 CDD:238102
SNc 193..328 CDD:214615
SNc 201..328 CDD:238102
Nuclear localization signal. /evidence=ECO:0000255 321..325
SNc 341..495 CDD:214615
SNc 350..496 CDD:238102
Nuclear localization signal. /evidence=ECO:0000255 388..392
SNc 525..660 CDD:214615 26/182 (14%)
SNc 533..660 CDD:238102 24/174 (14%)
TUDOR 677..799 CDD:278965 30/146 (21%)
TUDOR 728..784 CDD:197660 14/73 (19%)
SNc <844..895 CDD:294094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.