DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and TDRD1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_942090.1 Gene:TDRD1 HGNCID:11712 Length:1189 Species:Homo sapiens

Alignment Length:501 Identity:92/502 (18%)
Similarity:177/502 (35%) Gaps:109/502 (22%)


  Fly    95 SKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTP 159
            |:|.....|  |..:||.|.       .|.:|:..|..:.:.|..|.   ::||: ||....:..
Human    11 SRNNLEAPP--CKMTEPFNF-------EKNENKLPPHESLRSPGTLP---NHPNF-RLKSSENGN 62

  Fly   160 HIDQMISTGQQQSTLRTQRP-SFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQE 223
            ..:..:...|.:..|.:|.. |...|.|..:.:|.. |:.|||:.|:   .|...|.....|...
Human    63 KKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVG-SKGDRKKLPA---GNSVSPPSAESNSPP 123

  Fly   224 KE-------------TEELAQAFEN--------LSVDVAP-----TDHQEKLKCEIYEDNEDEFV 262
            ||             :::|.:..||        |...:.|     |.|    :|.          
Human   124 KEVNIKPGNNVRPAKSKKLNKLVENSLSISNPGLFTSLGPPLRSTTCH----RCG---------- 174

  Fly   263 RDPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENA 327
                ::|.::..:.:.......|.....:...|:      ..:|:.|....|...||.:.:|   
Human   175 ----LFGSLRCSQCKQTYYCSTACQRRDWSAHSI------VCRPVQPNFHKLENKSSIETKD--- 226

  Fly   328 IPAYAVDHRVLDVDYPRD------------AVRSAFTLPARDIESI-IELQQRIRVQLVSLVNPH 379
                      ::|:...|            |.|..|:    |:.|: ::....|:..:....:|.
Human   227 ----------VEVNNKSDCPLGVTKEIAIWAERIMFS----DLRSLQLKKTMEIKGTVTEFKHPG 277

  Fly   380 NFNFWIYNDDFKDYEAQF-ANMQTFYESSESKNYTMPLFLITTDHLCVVRCT--SGWERAKVLGY 441
            :|...:|:.:..:|..|. |:::..|.:...|:| :|:    ...:|:.:.|  ..|.||.:...
Human   278 DFYVQLYSSEVLEYMNQLSASLKETYANVHEKDY-IPV----KGEVCIAKYTVDQTWNRAIIQNV 337

  Fly   442 RSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFF 506
            .....|  ..|..:|.|:...:....:..|.:...|.|...:...:|.:...:. ||:::.:...
Human   338 DVQQKK--AHVLYIDYGNEEIIPLNRIYHLNRNIDLFPPCAIKCFVANVIPAEG-NWSSDCIKAT 399

  Fly   507 HDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGW 552
            ..:::.:....|:..|.........|:.|.......|:..|||.|:
Human   400 KPLLMEQYCSIKIVDILEEEVVTFAVEVELPNSGKLLDHVLIEMGY 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 21/112 (19%)
TDRD1NP_942090.1 zf-MYND 170..206 CDD:280009 5/60 (8%)
TUDOR 260..383 CDD:278965 24/130 (18%)
TUDOR 316..364 CDD:119391 9/50 (18%)
TUDOR 490..611 CDD:278965
TUDOR 545..592 CDD:119391
TUDOR 712..832 CDD:278965
TUDOR 766..813 CDD:119391
TUDOR 936..1059 CDD:278965
TUDOR 994..1040 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.