DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tdrd5

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_021325008.1 Gene:tdrd5 ZFINID:ZDB-GENE-050208-502 Length:908 Species:Danio rerio

Alignment Length:695 Identity:155/696 (22%)
Similarity:255/696 (37%) Gaps:183/696 (26%)


  Fly     7 LSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGH--G 69
            |:.:||.|.||:|||...||.|.|.|||:|..|..:|...|||::....::.:|:.|.:...  |
Zfish     7 LAGLKKDVRSLLVSSKHGLTPEHLRRDYQSMLGFPMPLRLLGFRNVLDMVKEMPEVVRLEYQLDG 71

  Fly    70 QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPFPTY 134
            .:. :.|:....:..|::||     ||.| .||||      |:             |||.. |.|
Zfish    72 NII-LKAIGDDTTKGIEELV-----SKQR-DHKPK------PN-------------NRKGK-PGY 109

  Fly   135 QVPRNLKLPVSYPNYNRLLYP---------------------VHTP------------------- 159
                   ..:|||....::.|                     .|.|                   
Zfish   110 -------FNISYPRLQPVILPRRGQAKPALPAHLRSQLKQLLSHGPVRLSELESRYVAQFGKPLN 167

  Fly   160 -------HIDQMISTG-----QQQSTLRTQ-----------RPS-----FPCNANSKSLKVNDWS 196
                   .|.:|:|..     .|||...:|           :|.     |...:.|...::..:|
Zfish   168 VTQYGFFSISEMLSAAMDFIIMQQSRTGSQLLLRSAVTPQNQPENLMRRFSMQSTSPKQRLAGFS 232

  Fly   197 QK-----DRKQEPSKERNNQKYPKITTENKQEKET-----EEL-AQAFENLSVDVAPTDHQEKLK 250
            .|     :|:.|.|.:.::...|:...|.:..:||     ||| .|..|..:......:.:|||:
Zfish   233 PKASSLPERRPEVSLDPSSVSKPEPVKEEQSFEETVFKLEEELRQQILEKGTAGTVSQELKEKLR 297

  Fly   251 CEIYEDNEDEFVRD-PFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAV---------- 304
            ..:.|:.....:.: |..|..:..:|.......|.:|:| ....||.|...|...          
Zfish   298 KVVAENGNGISIHNLPTEYQRMHGEELPVSQCGFLSVTE-MVGALSDTLAIQRGTDESESHWMVV 361

  Fly   305 --KPLD--PPEDCLH----YASSDDGEDEN--------AIPAYAVDHRVLDVDYPRDAVRSAFTL 353
              ||:|  |.|..|.    ..||..||.:|        :.|..|.:|.  :.:...|:..|...|
Zfish   362 EFKPIDTQPCEPELSPGDGTTSSPTGELQNPSSRAFYFSCPESAWEHE--ETEPLTDSQESDAEL 424

  Fly   354 PA--RDIESIIELQQRIRVQLVSLV------------------------------NPHNFNF-WI 385
            ..  :.|..::.|...:.|..||.|                              :|..|.. :.
Zfish   425 RVANKTIHQMVNLFPELMVSRVSAVPLDAVRCQKLKPPVHRKERELLPVLVEQTESPSYFYIRFS 489

  Fly   386 YNDDFKDYEAQFANMQTFYESSE-SKNYTMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMT 449
            .|.:.:..|.....|::.|...: ::.|.:|...:....:|.|.....|....|:....|..:  
Zfish   490 QNKEARALENMMIEMRSCYSYPDVAERYRLPDAYVRPGQVCCVAPRDMWFYRVVIHEVFSETE-- 552

  Fly   450 IEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRL 514
            ::|..||.|||.:|.:.:::||...:|.||.|.:...||.:....: .|.|..|:.|..:...|.
Zfish   553 VKVYYVDYGDITKVERHSLRFLKACYADLPAQAVPAMLAGVRPITN-IWPASAVSCFQRLCCERT 616

  Fly   515 LYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGWVRRCTSA 559
            |.|.|.:.:.:...|.|.||.:: ..|.::.:||:.|..:.|::|
Zfish   617 LVAGVHSYQEDFLLLFLCDTNTE-EDVYVHLALIQEGHAQPCSAA 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 29/88 (33%)
TUDOR 379..488 CDD:278965 26/111 (23%)
tdrd5XP_021325008.1 LOTUS_1_TDRD5 3..97 CDD:193599 33/97 (34%)
LOTUS_2_TDRD5 133..202 CDD:193589 9/69 (13%)
LOTUS_3_TDRD5 289..364 CDD:193590 14/76 (18%)
TUDOR 472..592 CDD:306940 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4890
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1115068at2759
OrthoFinder 1 1.000 FOG0005690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22948
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.