DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tdrd7

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001011355.2 Gene:tdrd7 XenbaseID:XB-GENE-944683 Length:1088 Species:Xenopus tropicalis

Alignment Length:686 Identity:134/687 (20%)
Similarity:241/687 (35%) Gaps:204/687 (30%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTV--TVTGH 68
            |..||.|::.:::.::...:.:.:|..:|:|..|..:|:..:||...:::|:|||..|  .|:..
 Frog     5 EKELVAKMLRAVLQANKNGVPLSKLQAEYKSFTGEPIPFKDMGFHALDAYLKSIPSVVRIEVSRV 69

  Fly    69 GQMAWITAVATAKSAHIQKLVRCQKKSKNRG----------------SH--KPKYCYA----SEP 111
            |::. ..||...::|.|..||..|:.||.:.                ||  |||....    :.|
 Frog    70 GEVI-CYAVVCKETARIAALVAHQRSSKKKSGGQVNCQMRLKYTAPVSHFGKPKATLRQPGFTPP 133

  Fly   112 SNLVFINESVSKMKNRKAPFPT---------------YQVPRNLKL----PVS--YPNYNR---- 151
            ...:.           :.|.||               |..|...:|    |:.  .||.||    
 Frog   134 QEKII-----------RKPVPTSAWGKGNTFGSRTFEYSPPPIPQLFGIAPIQMHLPNINRPERK 187

  Fly   152 -------------LLYPV--------HTPHIDQMI-STGQQQSTLRTQRPSFP--CNANSKSL-- 190
                         .|.|.        ||..:..:: .:||.:..|...:.:..  .|.:|..|  
 Frog   188 VTLPPRFQREVNSFLNPTPMTDSNANHTQSLKSVVPGSGQPRCDLSVIQNNLKELLNKHSNGLWL 252

  Fly   191 -KVNDWSQKDRKQEPSKERNNQ----------------------------KYPKITTENKQEKET 226
             |:....::..||:...|...|                            |.|.. |:|.|....
 Frog   253 SKLPQLYKETYKQDLGGEMLKQVPSWTHICMVQKLVTMGHTEMVLYSTAIKQPSF-TKNVQNHSN 316

  Fly   227 EELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVL--------AF 283
            .   ||..|:.||..|:....:....|.:|             |:|:|..:.:..        |.
 Frog   317 N---QAKPNVPVDSTPSSPPLQSSGNIPKD-------------ELKQKISKVLTKYSNGLWYHAL 365

  Fly   284 DAVSEDGF------DLLSMTTTQQNAVKPL--DPPEDCLHYASSDDGEDENAIPAY--AVDHRVL 338
            ..|.||.|      ::|::.:........|  :.|...:.||.|.:..::|:.|:.  .:..::.
 Frog   366 PKVFEDMFKQKLPTEVLNLDSLTDICTVDLISEEPFKAILYAKSAERANQNSNPSVNNNIPQKLQ 430

  Fly   339 DVDYP-------RDAVRSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDFKDYEAQ 396
            |.:.|       .:.......:|:....|::            :|...:.|..:.....:||.|.
 Frog   431 DRESPLLPEEPEMNMTPPPLVIPSEASPSVL------------VVELSSTNDVVIRYIGRDYSAA 483

  Fly   397 FANMQTFYESSESKNYTMPLFLITTDHLCVVRCTSG-WERAKVLGYRSSNNKMTIEVELVDIG-- 458
            ..:|:...:...||:.|..:..:....|...:.... |.||::    |:.....::|..||.|  
 Frog   484 QEHMEDEMKDFCSKSSTAKIGFLRVGQLVAAKAEEDVWLRAQI----SAIEGKKVKVCYVDYGFS 544

  Fly   459 ---DIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAK-- 518
               ||.:|.:     |.|.|..||.|.        |:|:    .|.:..|..|.|:::.|..|  
 Frog   545 EIVDITKVCK-----LGKQFYTLPFQA--------TKCR----LAGLEAFCDDSIIIKALELKAC 592

  Fly   519 -----VEAIKNNTAYLVLVDTESQGHTVNLNRSLIE 549
                 ||.::.:...||::...|....:|:|.:.::
 Frog   593 GKILAVEILEKSEKPLVVLYDTSGDDDININAACLK 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 24/88 (27%)
TUDOR 379..488 CDD:278965 26/115 (23%)
tdrd7NP_001011355.2 LabA_like_C 7..93 CDD:301363 24/87 (28%)
LabA_like_C 232..298 CDD:301363 9/66 (14%)
LOTUS_3_TDRD7 342..407 CDD:193588 13/78 (17%)
TUDOR 452..573 CDD:278965 32/154 (21%)
TUDOR 509..554 CDD:119391 12/49 (24%)
TUDOR 644..767 CDD:278965
TUDOR 699..744 CDD:119391
TUDOR 901..1016 CDD:278965
TUDOR 952..997 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.