DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and vret

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_651092.1 Gene:vret FlyBaseID:FBgn0263143 Length:691 Species:Drosophila melanogaster

Alignment Length:457 Identity:80/458 (17%)
Similarity:156/458 (34%) Gaps:118/458 (26%)


  Fly   116 FINESVSKMKNRKAPFPTYQVPRNLK--LPVSYPNYNRLLYPVHTPHIDQMISTG-------QQQ 171
            :.|||..|: ..:||.|    |::.|  .......|..|:.|..:|::.:.:...       ::.
  Fly    28 YTNESGQKL-IMEAPLP----PKDEKEQRATRQAKYPYLVVPKSSPYVTEKMLINFFGRALIKEM 87

  Fly   172 STLRTQRPSFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPK----ITTENKQEKE-TEELAQ 231
            ...|..|..|....|..||:             :.::..|:||.    ||...::|:| |.:...
  Fly    88 EFRRLSRVYFVYFENIASLE-------------TAQQRVQRYPNLIKCITGRPQKEREITSDPVT 139

  Fly   232 AFENL--------SVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAFDAVSE 288
            :.|.:        :.:..|.:|..::.......|..||.|.|.                   |::
  Fly   140 STEPMPTPGPAISATERTPVNHNREVPISTGGQNHPEFFRPPL-------------------VTK 185

  Fly   289 DGFDLLSMTTTQQNAVKPLDPP-EDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPRDAVRSAFT 352
            |.:...|:..|.....:.|:.. |..|........:||..||...:.            .||..|
  Fly   186 DDYKRGSLLATNDPIQRYLNVKYEFALERHDIYKLKDETRIPQVVLH------------FRSGRT 238

  Fly   353 LPARDIESIIELQQRIRVQ--LVSLVNPHNFNFWIYNDDF-KDYEAQFANMQTFYESSESKNYTM 414
            :|...:....|.:.:..::  :...|...|     :.|.| |..:..|.|...|.:.:|..... 
  Fly   239 IPLSTVAVTEEDKTKSLLEDGVSKCVVCQN-----WTDTFCKLCKMPFCNASCFADVAEQHKQA- 297

  Fly   415 PLFLITTDHLCVVRCTSGWERAKVL-------------GYRSSNNKMTIEVELVDIGDIIRVSQQ 466
                          |..|    ::|             |...|.:|  :.:...:..:::.|...
  Fly   298 --------------CGKG----EILNLDEKVGRKYPKPGLPPSGSK--VRITAFEQTNVVYVRSA 342

  Fly   467 NVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLVL 531
            :::..|..:.:|....:.|:.|  ::.:|.....::|.:..:..:.|.:...|:.||.  .|:|.
  Fly   343 DIQIDIAYYTVLTEVMMLGKDA--SKLQSTPVCGQIVLYKFEGHMSRAMVLNVDNIKE--IYVVF 403

  Fly   532 VD 533
            :|
  Fly   404 ID 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 18/123 (15%)
vretNP_651092.1 TUDOR 320..438 CDD:278965 16/93 (17%)
TUDOR 374..419 CDD:119391 8/35 (23%)
TUDOR 520..640 CDD:278965
TUDOR 577..622 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.