DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and qin

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_650735.3 Gene:qin FlyBaseID:FBgn0263974 Length:1857 Species:Drosophila melanogaster

Alignment Length:636 Identity:120/637 (19%)
Similarity:200/637 (31%) Gaps:184/637 (29%)


  Fly    16 SLVVSSPGKLTVEQLMRDYRSEEGCTL--PYSKLGFKDAESFLRSIPDTVTVTGHGQMAWITAVA 78
            |.|..:|.::|..:.| |..:...|..  |..::.||......||:    :.:..|::.::|:.:
  Fly   385 SKVDENPYRVTCSRFM-DISNIFKCEFVNPNIQVCFKTDLEISRSL----SSSPKGEITFLTSSS 444

  Fly    79 TAK---SAHIQKLVRCQ----KKS-------KNRGSHKPKYCYASEPSNLVFINESVSKMKNRKA 129
            ::|   ..|.:||:..|    ||:       |.||.:..:...:|..|....|:|..:|..:...
  Fly   445 SSKENFDPHSRKLLLAQNSKLKKATQVSQSQKKRGKNATEVAQSSLNSTAAIIDEFPAKDLDFLH 509

  Fly   130 PFPTYQVPRNLKLPVSYPNYNRL-----LYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKS 189
            .|.:..:.:..|......::.:.     :..|.:|. |..:........||.:..:|....:..|
  Fly   510 NFSSLDITKRNKTTEDSSDWFKTDTLVRVRSVQSPE-DFYVQGIHAAQRLREELDTFAHTLSDSS 573

  Fly   190 -------------LKVNDWSQKDRKQEPSKERNNQKYPKITTE---------------------- 219
                         :...|..:..|.....|..|...|....|:                      
  Fly   574 SVPPTIVVGQNYIIHHKDKDRYYRALVSQKLTNENLYNVFLTDIGVHLHVRCSDFRVVPERISHL 638

  Fly   220 --------------NKQEKETEELAQAFENLSVDVAPTD-----------HQEKLKCEIYEDNED 259
                          ...|.|.:..|.||....|...|..           |...|....|:.|..
  Fly   639 PYSAVHCSLSELMPKNGESEWDSKASAFLKQIVQNNPVRVIVKKALTYELHGVDLITSNYDTNIS 703

  Fly   260 EFVRDPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGED 324
              |||.|:|..:             |:|.||..|.            |.|....|.         
  Fly   704 --VRDSFLYCGL-------------AISRDGAPLW------------LPPAPTALR--------- 732

  Fly   325 ENAIPAYAVDHRVLDVDYPRDAVRSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDD 389
                             .||.:.|..      |:         ..||::.:.:|..|....::.:
  Fly   733 -----------------LPRISFRFG------DV---------YMVQMLHVEDPQEFYVMRHDYE 765

  Fly   390 FKDYEAQFANMQTF--YESSESKNYTMPLFLITTDHLCVVRCTSGWERAKVL-----GYRSSNNK 447
            .|....||:..:..  ...|:.:|    :||......||::....|:||.:.     ||      
  Fly   766 KKRLWLQFSLQEAMDRINISQLQN----IFLGQLHLGCVLQSGGQWKRASIEQILPDGY------ 820

  Fly   448 MTIEVELVDIGDIIRVSQQNVKFLIKPF---ALLPRQCLAGRLAFITQCK-SPNWTAEVVNFFHD 508
              :.|.|||.|...:|....:..|.:.|   .|..:.|||.   ..|:.: |..||.|....|..
  Fly   821 --VLVHLVDEGPSQKVFWDQLFVLPQKFWDTGLAIKCCLAD---VETRAEHSYTWTPEGTTLFKQ 880

  Fly   509 MILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGWVRRCTSA 559
            :.....||..|.:...:..|:.|....|...|.::...|:..|   .|||:
  Fly   881 LTSNPRLYMDVISCTEDLVYVSLHFERSNSETTSVGVQLVAHG---HCTSS 928

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 19/86 (22%)
TUDOR 379..488 CDD:278965 27/119 (23%)
qinNP_650735.3 zf-RING_5 25..75 CDD:291308
BBOX 139..174 CDD:197662
TUDOR 536..648 CDD:278965 13/113 (12%)
TUDOR 741..859 CDD:278965 31/145 (21%)
TUDOR <805..839 CDD:119391 11/42 (26%)
TUDOR 981..1107 CDD:278965
TUDOR 1296..1403 CDD:278965
TUDOR 1337..1385 CDD:119391
TUDOR 1710..1761 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.