DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and CG9925

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_650324.1 Gene:CG9925 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster

Alignment Length:578 Identity:103/579 (18%)
Similarity:178/579 (31%) Gaps:215/579 (37%)


  Fly    90 RCQKKSKNRGSHKPKYCYASEP-----------SNLVFINESVSKMKNR-KAPF----PTYQVPR 138
            :|||....|  |: :.|....|           :.:..:...|:..|.| |:|.    ||..||.
  Fly    31 KCQKLDWQR--HR-QVCIIMPPLVECRPLQPALNPIQSVENQVALAKTRTKSPIPCVEPTVAVPN 92

  Fly   139 N------------------LKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNA 185
            .                  .|..|::...:..::.||..:::.:     ::.|:..||    |..
  Fly    93 KPDLSENWRKHLLPSGMEFFKCRVTFMENDGPIWVVHVANVEAI-----ERMTVNMQR----CMQ 148

  Fly   186 NSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLK 250
            |.|.:::....:.........::.::.:.....:.|||              .:|...||     
  Fly   149 NKKMIRMEGVREDTLVAISVGDKVHRGHVLTVCQKKQE--------------ANVRMIDH----- 194

  Fly   251 CEIYEDNEDEFVRDPF--IYGEV-KEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPED 312
                    .:.|..||  ||..| |..|.:|........:..|...:...|.:....|       
  Fly   195 --------GQIVATPFRDIYTIVPKMAESKAFAFRVQLPTNTGVQDIKNLTLRMLGTK------- 244

  Fly   313 CLHYASSDDGEDENAIPAYAVDHRVLDVDYPRDAVRSAFTLPARDIESIIELQQRIRVQLVSLVN 377
                  :.||       ||.|..:      |:..:  ..:||.    .:::|...::|..|...|
  Fly   245 ------TSDG-------AYHVHLK------PKMII--PLSLPL----EMLQLNPEVKVIRVFKAN 284

  Fly   378 P-HN------------------FNFWIYNDDFKDYEAQFANMQT-FYESSESKNYTMPLFLITTD 422
            | ||                  .|..|.....:.:...|...:: |:.::.:||.....||:  |
  Fly   285 PKHNEPQLALLQINVMGHVNADLNNRIAEKPRQPFTLPFPEQKSIFFAATRTKNGYRRAFLL--D 347

  Fly   423 HLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDI-----GDIIRV-----------------SQ 465
            |:...|.|       .|.|.....:::|..:|..|     |...||                 ::
  Fly   348 HIMKPRPT-------YLVYEMDEGRVSIATDLSRIPSELLGLPSRVFAAQLEDSVPEELETQGAE 405

  Fly   466 QNVKFLI--KPFALLPRQ----------------CLAGRLAFITQCK---SPNWTAEVVNFFHDM 509
            ..|||.:  ||    |::                |:|..:.|:.|..   ...|...:|   ||.
  Fly   406 LTVKFKLDNKP----PKEKLRAANAALNSKGEQICMARLITFLGQISYLGHKYWREPIV---HDS 463

  Fly   510 ILL-------------------------RLLYAKVEAIKN---NTAYLVLVDTESQGH 539
            |:.                         ||.|......|:   :...:|||.::..||
  Fly   464 IVFISHLVSFKEVYISTPDAKQYAEIFKRLEYKCATITKSSDVSVGSIVLVVSKQMGH 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 2/3 (67%)
TUDOR 379..488 CDD:278965 30/168 (18%)
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009 5/16 (31%)
TUDOR 109..225 CDD:278965 25/152 (16%)
TUDOR 457..573 CDD:278965 13/69 (19%)
TUDOR 718..843 CDD:278965
TUDOR 779..825 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.