DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tdrd7a

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001092813.1 Gene:tdrd7a ZFINID:ZDB-GENE-040426-2103 Length:1079 Species:Danio rerio

Alignment Length:698 Identity:151/699 (22%)
Similarity:242/699 (35%) Gaps:224/699 (32%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGH-- 68
            ::.||||::.:::.||...:.:.:|..|||:..|..:|:.|.|....||||||||..|.:...  
Zfish     3 DVELVKKMLRAVLQSSKHGVAMARLQGDYRALTGEMIPFRKFGHDTLESFLRSIPGVVRLERSIA 67

  Fly    69 GQMAWITAVATAKSAHIQKLVRCQKKSKNRG-----------------SH--KPKYCYASEPSNL 114
            |::.....|. .::|||.:||..||..|..|                 ||  ||:.. ..:|||:
Zfish    68 GEVMCFAGVC-EETAHIAQLVARQKNVKKTGCSKLLNFQMRTRTSHLFSHNVKPRLS-LRQPSNM 130

  Fly   115 VFINE-SVSK---------------------MKNRKAPFP--TYQVP----RNLKLPV----SYP 147
            ..... ||:.                     ..|||:|.|  |..||    .|:|.|:    ..|
Zfish   131 THPGRGSVTSFYSTQRKLYSTDLPSSRAPAWQMNRKSPVPEKTSVVPSKINTNIKTPLKKTSGTP 195

  Fly   148 NYNRLLYPVHTPHID----------QMISTGQQQSTLRTQRPSFPCNANSKSL----KVNDWSQK 198
            ...:   ||:...::          |..|:|...|.:    |....:...:.|    :|..|:..
Zfish   196 AQQK---PVNRADVELVQGRIKQLLQKYSSGVWLSKI----PQLYKSMFQEELHIIQEVEKWTHI 253

  Fly   199 DRKQEPSKERNN----------QKYPKI--------------TTENKQEKETEELAQAFENLSVD 239
            ...::|..  ||          :..||.              |...||...|::..:.|..|:::
Zfish   254 CTVEKPGS--NNIVDRLVYPVLEPVPKASPVPVKSPCKQSPNTALLKQPTLTQKTTRTFRTLAIN 316

  Fly   240 VAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAV 304
            :..:..:.:........|                    :.::.| .:||         |.:..::
Zfish   317 IPQSTPKPQTPLSPTSPN--------------------STMMDF-TLSE---------TPKTQSL 351

  Fly   305 KPLDPPE-DCLHYASSDDGEDE--------------------------NAIPAYAVDHRVL---- 338
            .|:.||. ...|...:.:.:.:                          .|.|.|.::...|    
Zfish   352 SPITPPSTPPAHQPLTTELKQKLRQLLNKYSQGLWAHGLPQLFQEAFGCAFPQYVLEDLSLLADT 416

  Fly   339 -DVDYPRDAVRS---AFTLPARDIESIIELQQRIR---VQLVSLVNPHNFNFWIYNDDF------ 390
             .|:||....|.   .:|||.:     ::.|.|.|   :.|....|||.....|...||      
Zfish   417 CMVEYPMPDNRKRAILYTLPCQ-----VQTQPRSRPPPLVLPCTSNPHVPPLIIPTADFHSVFVI 476

  Fly   391 ------------------KDYEAQFANMQTFYESSESKNYTMPLFLIT--TDHLCVVRCTSG-WE 434
                              |..|.....||.||     .|....|.|::  ...|..|..:.| ..
Zfish   477 EINSTNNVVVRFAGEGYSKSLEVMEEEMQNFY-----NNIGAGLCLLSPKIGQLVAVASSDGAML 536

  Fly   435 RAKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQC----LAGRLAFITQCKS 495
            ||:|  ::.|.:|  ::|..:|.|....||::.|..|...|..||.|.    |||...|.|.   
Zfish   537 RAQV--HQLSEDK--VKVYFLDHGFFDLVSRKTVFQLRDQFMTLPFQATTCQLAGLEPFSTD--- 594

  Fly   496 PNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNL 543
                ..|:.....:.:.|.|.|:: ..:.:|..:||.|| |:...||:
Zfish   595 ----PVVLKTLQSLAVGRSLLAEI-VEREDTPLVVLYDT-SENDDVNV 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 31/88 (35%)
TUDOR 379..488 CDD:278965 35/140 (25%)
tdrd7aNP_001092813.1 LOTUS_1_TDRD7 4..91 CDD:193600 31/88 (35%)
LOTUS_2_TDRD7 206..271 CDD:193587 11/71 (15%)
LOTUS_3_TDRD7 367..434 CDD:193588 8/67 (12%)
TUDOR 465..587 CDD:278965 33/131 (25%)
TUDOR 520..573 CDD:197660 15/57 (26%)
TUDOR 659..778 CDD:278965
TUDOR 712..757 CDD:119391
TUDOR 891..1007 CDD:278965
TUDOR 945..988 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17287
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.