DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tapas

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_611475.3 Gene:tapas FlyBaseID:FBgn0027529 Length:1222 Species:Drosophila melanogaster

Alignment Length:808 Identity:150/809 (19%)
Similarity:248/809 (31%) Gaps:338/809 (42%)


  Fly     7 LSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGH--G 69
            |..|.|||.:|:.|:...:|:..::.||...||..:|:.:||:.:.:..|:   |:.....|  |
  Fly     7 LEYVAKVVRALITSAKPPVTLRSIVADYMEIEGEPIPFRRLGYSNDQELLK---DSNQFNFHQSG 68

  Fly    70 QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPFPTY 134
            ...:|||...|.:.||.::||.||.||                     :.|:||      |.|..
  Fly    69 NQVFITAKYNANTEHIVRMVRQQKTSK---------------------STSLSK------PTPIA 106

  Fly   135 QVPRNLKLPVS--------YPNYNRLLYPVHTPHID---------QMISTGQQQST-LRTQR--P 179
            |.|:    |::        |....|...|.|.|..:         |.|:..:|..| :.||.  .
  Fly   107 QKPK----PIAQKHTHGNKYHYQQRNKQPNHQPDQEIGRAAKCENQAIAEHKQDLTGIITQELFE 167

  Fly   180 SF-----PCNANSKSLKVNDWSQKDRKQEPSKERN---NQKYPKITTENKQEKETEELAQAFENL 236
            ||     |.:.|.:....|......||:|..||.:   .|...::..|.::||||.:.| ..|.:
  Fly   168 SFNNIQGPFSENLQVFNKNPEYITRRKKELKKEDDLDRGQITKEVAREKQKEKETRDRA-VTETI 231

  Fly   237 SVDV----AP-------------------TDHQEKLKC--------------EIYEDNEDEF--V 262
            .|.:    ||                   .|.:..|:.              .:|...|..|  .
  Fly   232 FVTIENKKAPVMNGHGPRHVKVANGQDKHNDGKPPLRAILGNSASQRQQDTSTVYHSPESSFKRP 296

  Fly   263 RDPFIYGEVKEK--------------EDEAVVLAFDAVSEDGFDLLSMTTTQQNA---------- 303
            |.|.:.....::              :.:|...|...::.......:.|||...|          
  Fly   297 RHPRVMYPGHQRTTGVSVNHRLKVTPQSDAPTPAVAPITPPASPEYAQTTTAAKATYKEDIHGGQ 361

  Fly   304 -----------VK-------PLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDV---------- 340
                       ||       .|||......|.:::|.|.    |||.:.:::.::          
  Fly   362 GETGNVVTNPKVKVPLKFDPSLDPVSTLNFYCAANDFEK----PAYNIFNKLRNLHCSVQIAGDV 422

  Fly   341 --DYPRD--------------AVR-----------SAFT-------------------------- 352
              .||::              |::           ||.|                          
  Fly   423 YSSYPQEFTDKETAYQRTAQIAIQRIMHAQSHQKLSACTFSDVEFIDGLYKELLKHPHGILGHKL 487

  Fly   353 -----------LPARDIESIIELQQRIRVQ--------------------------LVSLVNP-- 378
                       ||:...:.|:: ..:|||:                          |..:|.|  
  Fly   488 EDWYGSTFRQHLPSHWYDLIVK-SNKIRVEHGIDPRIILFANDPGSSEPDRTSITTLPQMVLPWQ 551

  Fly   379 ------HNFNFWI-YNDDFKDYEA----QFANMQTF------------YESSESKNYTMPLFLIT 420
                  |::|.:| :.|..|...|    |.||.:..            :....||.|...::|  
  Fly   552 SSEGGSHDWNMFISFCDSTKIVWARMIDQIANFEELTKHIGRQMESPHFRQKVSKPYAQEVYL-- 614

  Fly   421 TDHLCVVRCTSGWERAKVLGY----RSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQ 481
                  |....||.|.:.:..    ||.      ....:|.||:.....:::......|..||.|
  Fly   615 ------VEMPDGWNRVRAISVDEETRSG------RYHFIDFGDVAMFHSEDLFHCPPQFLALPAQ 667

  Fly   482 CLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLN-- 544
            .:         |.|                   :|| ::..:::...|.::..|..|.||..:  
  Fly   668 AV---------CLS-------------------MYA-LDKFEDHPHALQVLTKELDGQTVVAHVL 703

  Fly   545 -------------RSLIETGWVRRCTSA 559
                         :.::|.|..|.|..|
  Fly   704 TTEKQFLELGGSAQGVVENGKRRACLVA 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 28/88 (32%)
TUDOR 379..488 CDD:278965 26/130 (20%)
tapasNP_611475.3 LOTUS_TDRD_OSKAR 7..92 CDD:193586 28/88 (32%)
TUDOR 563..673 CDD:278965 26/152 (17%)
TUDOR 766..896 CDD:278965
TUDOR 1032..1151 CDD:278965
TUDOR 1087..1131 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.