DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and rnf17

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_021334643.1 Gene:rnf17 ZFINID:ZDB-GENE-030131-6451 Length:1521 Species:Danio rerio

Alignment Length:507 Identity:99/508 (19%)
Similarity:167/508 (33%) Gaps:142/508 (28%)


  Fly   103 PKYCYAS-EPSNLVFINESVSKMKNRKAPFPTY-QVPRNLKLPVSYPN----YNRLLYP------ 155
            |...|.| :||..|.:|..||.:   ..|...| |:..|.:.|:.:..    ||:   |      
Zfish   618 PLLFYPSVQPSLNVEVNAMVSHV---NTPSDFYVQLVENTEYPLLHSKLQDCYNQ---PKSNNEC 676

  Fly   156 -VHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKY---PKI 216
             |:.|.:.|.......|...|.|...|| ......::..|:..|.............::   |::
Zfish   677 QVYCPSLSQACVAFHDQEWSRVQVTGFP-GGRMVEVRFVDFGYKRTLSVKDLRHIKDEFFVLPEM 740

  Fly   217 T-------TENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEK 274
            .       ..:.||....|..::|:.|.        :.||...:.:.|.......|....|:.:.
Zfish   741 ALWCNLNDVISSQETWANEACESFKELV--------EGKLMTVVAKKNVPSSKPVPVCLFEISDD 797

  Fly   275 ------EDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPL-----DPPEDCLHYASSDDGEDENAI 328
                  .||.|...:...::|         ||....:||     |||            .:|.|:
Zfish   798 CTGASIGDELVKKGYAVYNKD---------TQVRDAQPLETTSWDPP------------FEEEAL 841

  Fly   329 PAYAVDHRVLDVDYPRDAVRSAFTLPA--RDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDFK 391
            |.      |:......:.::.:.:||:  :|          |||::..:.:|.|....:      
Zfish   842 PV------VMTPSSASEELKPSLSLPSCLKD----------IRVRVTHVTSPGNICVQL------ 884

  Fly   392 DYEAQFAN--------MQTFYESSESKNYTMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKM 448
               .||.|        ::..:..||.:....     ..:..|.|..|..|||.:|....:..   
Zfish   885 ---LQFDNQLKRIHDTLKNLFSKSEPQEMQW-----EAEMYCAVNNTGVWERGQVCSVSTCG--- 938

  Fly   449 TIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCK---------SPNWTAEVVN 504
            ..||...|.|:.:::...|::.|        ...|.|  :|:.:|.         ...|||...:
Zfish   939 VAEVLRCDFGNTVKLHVDNLRPL--------HPDLIG--SFLLECNLSGVRPAGGRSTWTATACD 993

  Fly   505 FFHDMI--LLRLLYAKVEAIKNNTAYLVLVD---TESQGHTVNLNRSLIETG 551
            |....:  .:.|:     |||..:...|||.   :...|..|:....||..|
Zfish   994 FISHYLTGAMALM-----AIKEPSTRPVLVSLFCSNRAGQNVSFADFLISEG 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 21/117 (18%)
rnf17XP_021334643.1 RING_Ubox 8..60 CDD:327409
TUDOR 394..534 CDD:306940
TUDOR 633..746 CDD:306940 22/120 (18%)
TUDOR 865..977 CDD:306940 28/149 (19%)
TUDOR 1092..1214 CDD:306940
TUDOR 1326..1450 CDD:306940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.