DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and papi

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_608657.1 Gene:papi FlyBaseID:FBgn0031401 Length:576 Species:Drosophila melanogaster

Alignment Length:325 Identity:57/326 (17%)
Similarity:111/326 (34%) Gaps:81/326 (25%)


  Fly   222 QEKETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAFDAV 286
            ||..:..||:    |::|:  .....|.|..|..:.:...:....:..::  :|||.:|.:.:.|
  Fly   160 QEIRSSSLAK----LNIDL--NGRNGKAKITIIGNQKQVNIARKMLDDQI--EEDEELVRSMEEV 216

  Fly   287 SE-------DGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPR 344
            .:       ....:.|...:.|.::.....|.|.| .||..:|:                   |.
  Fly   217 EQRREPRRSPTNSIASSMYSSQTSLSSHTQPRDKL-MASKGEGK-------------------PM 261

  Fly   345 DAVRSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWI--YNDDFKDYEAQFANMQTFYESS 407
            :...||...|.:                          ||:  .....|..::....|.::|.|:
  Fly   262 EVYVSAVASPTK--------------------------FWVQLIGPQSKKLDSMVQEMTSYYSSA 300

  Fly   408 ESKNYTMPLFLITTDHL-----CVVRCTSGWERAKVLGYRSSN---NKMTIEVELVDIGDIIRVS 464
            |::    ...::|..::     .|.:....|.||:::....:.   .:..|::..||.||...:|
  Fly   301 ENR----AKHVLTAPYVGQIVAAVFKFDEKWYRAEIVDIMPNQYNPKEQVIDLYFVDYGDSEYIS 361

  Fly   465 QQNVKFLIKPFALLPRQ---CLAGRLAFITQCKSPNWTAEVVNFFHDMILL---RLLYAKVEAIK 523
            ..::..|...|..|..|   |....:....|.:...|....:..|.::..:   |.|.|:|...|
  Fly   362 PADICELRTDFLTLRFQAVECFLANVKSTIQTEPITWPKSSIAKFEELTEVAHWRKLIARVVTYK 426

  Fly   524  523
              Fly   427  426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 23/122 (19%)
papiNP_608657.1 KH-I 68..127 CDD:238053
KH_1 138..201 CDD:306517 9/47 (19%)
TUDOR 257..386 CDD:306940 28/178 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.