DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and snd1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_878285.3 Gene:snd1 ZFINID:ZDB-GENE-030131-3124 Length:913 Species:Danio rerio

Alignment Length:269 Identity:63/270 (23%)
Similarity:98/270 (36%) Gaps:87/270 (32%)


  Fly   202 QEPSKERNNQKYPKITTENKQEKETEELAQAFE-------NLSVDVAP-TD--H----------- 245
            :|.:::|..:.:     .|.:||..||:||..|       ..||.|.. ||  |           
Zfish   650 EESARQRKEKLW-----ANYEEKPKEEVAQVTEAKERVAKYRSVYVTEITDGLHFYAQDVETGTK 709

  Fly   246 ----QEKLKCEI---------YEDNEDEFVRDPFIYGE-----VKEKEDEAVVLAFDAVSEDGFD 292
                .|.::.||         :.....||....|..||     |::.|..|.|..| .:.....:
Zfish   710 LENLMESMRGEIAAQPPVEGSFAPRRGEFCIAKFADGEWYRARVEKVESPAKVHVF-YIDYGNRE 773

  Fly   293 LLSMTTTQQNAVKP------LDPPEDCLHYASSDDGEDENAIPAYAVDHRV---------LDVDY 342
            :||  :|:..|:.|      |.|......:|.....:||:| .|.|||..|         |:|:|
Zfish   774 VLS--STRLAALPPAFSTRTLPPQATEYAFAYIQVPQDEDA-RADAVDSVVRDIHNTQCLLNVEY 835

  Fly   343 -----PRDAVRSAFTLPARDI------ESIIELQQRIRVQLVSLVNPH----------NFNFWIY 386
                 |:..::.|.|  ..|:      |.::.:..|....|..:|..:          ..|.|.|
Zfish   836 SGSVCPQVTLQFADT--KEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIWRY 898

  Fly   387 NDDFKDYEA 395
            . ||:|.:|
Zfish   899 G-DFRDDDA 906

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 7/28 (25%)
snd1NP_878285.3 SNc 18..167 CDD:214615
SNc 26..167 CDD:238102
SNc 194..329 CDD:214615
SNc 202..329 CDD:238102
SNc 342..498 CDD:214615
SNc 351..499 CDD:238102
SNc 528..663 CDD:214615 2/18 (11%)
SNc 536..663 CDD:238102 2/18 (11%)
TUDOR 680..802 CDD:278965 26/125 (21%)
TUDOR 732..787 CDD:197660 15/58 (26%)
SNc 749..898 CDD:214615 34/155 (22%)
SNc <847..898 CDD:294094 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.