DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and spoon

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_726992.2 Gene:spoon FlyBaseID:FBgn0263987 Length:607 Species:Drosophila melanogaster

Alignment Length:560 Identity:105/561 (19%)
Similarity:184/561 (33%) Gaps:155/561 (28%)


  Fly    61 DTVTVTGHGQMAWITAVA---TAKSAHIQKLVRCQKKSKNRGSHKPKYCYASE-------PSNLV 115
            |:.|...:|:.|.|...:   |:...|.|::.....|||.:.:.....|...|       |.:|.
  Fly   119 DSPTTMLYGKSAPIKIQSNGRTSNGKHQQQIDSEILKSKIQDAEHKTLCSIDEDFENLSSPRDLP 183

  Fly   116 -FINESVSKMKNRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRP 179
             .:|..|| ..||||...|.:       ||       ::....||.|      ..:.|.|.|...
  Fly   184 DSVNTRVS-FYNRKATQKTVE-------PV-------VIKATRTPKI------SPENSFLDTNYT 227

  Fly   180 SFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTD 244
            :..|..|:..         :.|:|||               |:|.:.|||.|..|          
  Fly   228 NKECEQNNNC---------EPKEEPS---------------KKEADQEELEQDQE---------- 258

  Fly   245 HQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEA-VVLAFDAV-SEDGFDLLSMTTTQQNAVK-- 305
             |..||.|:.:.|           |..|...|.| ..|:..:| |.|.....|:..::...||  
  Fly   259 -QTVLKEEVVDSN-----------GNQKRNVDAASPSLSICSVQSGDSGKGSSLPRSEATRVKTT 311

  Fly   306 -----PL-----------------------------DPPEDCLHYASSDDGEDENAIPAYAVDHR 336
                 |:                             :|....:...:.:..|.|.......:..|
  Fly   312 YEFLFPISLIGHLYGRKRAFINQIKAKTLASVSVGKNPYSGKVRICTIEGTESEIDAALAMIRQR 376

  Fly   337 VLDVDYPRDAV-RSAFTLPARDIESIIELQQRIRVQLVSLVN-----------PHNFNFWIYNDD 389
            :....||...: |..|.||...:....|....::::|:..:|           .|.|   |.:..
  Fly   377 LPAKRYPNFTMQRIHFALPQTIVPLSTESLYNLQLKLIEGINNDVVVSAVLSGSHIF---IQHPL 438

  Fly   390 FKDYEAQFANMQTFYESSESKNYTMPLFLITTDHL---CVVRCTSGWERAKVLGYRSSNNKMTIE 451
            ...:.:.....:..|:|..    ||...|:.:..|   ||:.....|.|.:::.....:.:..: 
  Fly   439 HPSHPSLPLLQKQLYDSYS----TMEAPLLPSLELSAVCVIPINDVWYRVQIVDTDPEDEERCV- 498

  Fly   452 VELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPN-------WTAEVVNFFHDM 509
            ::.:|.|..:.|....::.:...|..:|.|.        |:|...|       |:.|.....:.:
  Fly   499 IKFLDFGGYMNVGFNTLRQIRTDFMNVPFQS--------TECILSNIEPIGGTWSIEAAEILNKL 555

  Fly   510 ILLRLLYAKVEAI-KNNTAYLVLVDTESQGHTVNLNRSLI 548
            ....:|.|:|... .:|...:.|..:....:.:.:|:.|:
  Fly   556 TKGIVLQAQVAGYNSHNLPEIFLFASLGPNNVIFINKELV 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 8/35 (23%)
TUDOR 379..488 CDD:278965 19/112 (17%)
spoonNP_726992.2 KH-I 311..373 CDD:238053 4/62 (6%)
TUDOR 413..536 CDD:278965 23/139 (17%)
TUDOR 465..522 CDD:295375 8/58 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22948
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.