DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Rnf17

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001178614.1 Gene:Rnf17 RGDID:1310486 Length:1640 Species:Rattus norvegicus

Alignment Length:615 Identity:120/616 (19%)
Similarity:232/616 (38%) Gaps:165/616 (27%)


  Fly     5 GELSLVKKVVHSLVVSSPGKLTV------------EQLMRDYRSEEGC-------TLPYSKLGFK 50
            ||....:|.|  |||:||..:.|            |:::.:  :.|.|       |..|.|   |
  Rat   367 GENKQPQKEV--LVVASPKTVAVLPQLGSSPDVIIEEIIEE--NLESCFTDEPIETPRYPK---K 424

  Fly    51 DAESFLRSIPDTVTVTGHGQMAWITAVA------TAKSAHIQKLVRCQKKSKNRGSHKPKYCYAS 109
            ..:..| |.| ..:..|..::.:::.|.      ..|.:.|:.....:||.|       :.|..|
  Rat   425 PPQKEL-SAP-VASKAGCPELVFVSHVTHPCHFYVRKYSQIKDAAMLEKKMK-------QVCSKS 480

  Fly   110 ---EPSNL------VFINESVSKMKNRK--APFPTYQVP---RNLKLPVSYPNYNRL------LY 154
               :||:.      :|:|    .:|||.  ....|..:|   :|::.|.|...::..      ::
  Rat   481 LHLDPSDTLELGARIFVN----SIKNRMWCRGIITEIIPTKTKNVRKPCSPTKFSVCEISLIQIF 541

  Fly   155 PVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTE 219
            .|...:.:.:|.||...:.:.      |.:...:.:.::|:....||.||               
  Rat   542 MVDFGNSEVLIITGVGDTHVG------PEHVGEQHITLSDFCLLVRKSEP--------------- 585

  Fly   220 NKQEKETEELAQAFENLS-----VDVAPTDHQE----KLKCEIYEDNEDEFVRDPFIYGEVKEKE 275
                 .:|||.:...:|:     .|:.|.:..|    :.|.|..     :.|....:..:|..:|
  Rat   586 -----YSEELLKDIPHLAHLCSLKDIVPYNSSEGWEKEAKVEFL-----KMVNKKAVLMKVFGEE 640

  Fly   276 DEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHY---------ASSDDGEDENAIPAY 331
            |:.:::          ||....|.:.::..|:. ..|.|.:         :....||:..|:   
  Rat   641 DDILIV----------DLQKPPTNKISSDMPVS-LRDALVFMELARFRSQSLRSHGENNTAL--- 691

  Fly   332 AVDHRVLDVDYPRDAVRSAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDFKDYEAQ 396
                              .:..||     :.|....:.|.:..:.:|.:|...:..:  .|:.:.
  Rat   692 ------------------CYRPPA-----LPEEMTEVSVMVCHINSPTDFYLQLMEN--LDFLSL 731

  Fly   397 FANMQTFYESSESKNYTM--PLFLITTDHLCVVRCTSG-WERAKVLGYRSSNNKMTIEVELVDIG 458
            ...::.||:..:.:|..:  ||    .:..||.:...| |.||||:|......   :||:.||.|
  Rat   732 LKTIEEFYKGEDGENLEILCPL----QNQACVAKFEDGIWYRAKVIGLPGHRE---VEVKYVDFG 789

  Fly   459 DIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIK 523
            :..:::.::::.:...|...|.:.:..:||||...|..:|:.:....|.:....:.:...|..|.
  Rat   790 NTAKITLKDMRKIKDEFLEPPEKAIKCKLAFIEPSKRSHWSKKAKEKFEEKTQDKFVTCSVIKIL 854

  Fly   524 NNTAYLV-LVDTESQG-HTVNLNRSLIETG 551
            .|...|| |.|:.:.| ..|::|..|::.|
  Rat   855 ENGVLLVELFDSRAPGTSAVSINEQLVKEG 884

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 22/111 (20%)
TUDOR 379..488 CDD:278965 24/112 (21%)
Rnf17NP_001178614.1 PHD_SF 30..72 CDD:304600
iSH2_PI3K_IA_R 137..>242 CDD:304922
TUDOR 444..>551 CDD:278965 21/118 (18%)
TUDOR 698..819 CDD:278965 27/130 (21%)
TUDOR 755..801 CDD:119391 14/49 (29%)
TUDOR 937..1053 CDD:278965
TUDOR 990..1036 CDD:119391
TUDOR 1196..1312 CDD:278965
TUDOR 1250..1295 CDD:119391
TUDOR 1426..1567 CDD:278965
TUDOR 1501..1548 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.