DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Tdrd1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001099672.1 Gene:Tdrd1 RGDID:1306140 Length:1173 Species:Rattus norvegicus

Alignment Length:640 Identity:122/641 (19%)
Similarity:209/641 (33%) Gaps:213/641 (33%)


  Fly    91 CQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPFPT--------------YQV---PR 138
            |::..:...|.:.....:|.|:.   ||..|...|..:...||              .||   |.
  Rat    62 CEQNKQYLASQEDNSVVSSNPAG---INGEVGGSKGDRKTLPTGNPVSLSLGNNSPPNQVKTKPS 123

  Fly   139 NLKLPVSYPNYNRLL---YPVHTPHIDQMISTGQQQST---------LRTQ--RPSFPCNANSKS 189
            |...|......::|.   ..|:.|.:...:....:.:|         ||..  :.::.|   |.:
  Rat   124 NAVTPEKSKKSHKLFENALSVNNPALFNSLGPPLRSTTCHRCGLFGSLRCSQCKQTYYC---STA 185

  Fly   190 LKVNDWSQKDRKQEPSK------ERNNQKYPKITTENKQEKE-----TEELAQAFENL------- 236
            .:..|||.......|.:      |.|...:...|.:.|.|..     |:|:....|.:       
  Rat   186 CQRRDWSSHSTICRPVQQSLHKLEDNKSPFETKTIDVKNEVACPLGVTKEMTAGAERVMFSDLRS 250

  Fly   237 -----SVDVAPT--------------------DHQEKLKCEIYEDNEDEFVRDPF--IYGEV--- 271
                 |:::..|                    ::..:|...:.|...:....|.:  :.|||   
  Rat   251 LQLRKSMEIKGTVTEFKHPGHFYVQLYSSEVLEYMNQLSASLKETYANMVPEDGYLPVKGEVCVA 315

  Fly   272 KEKEDE----AVVLAFDAVSEDGFDLLSMTTTQQNA-----------VKPLD------------P 309
            |...|:    |||        :|.|:|     |:.|           :.|:|            |
  Rat   316 KYTVDQTWNRAVV--------EGVDVL-----QKKAHVLYIDYGNEEIIPVDRIHQLSRSISLFP 367

  Fly   310 P------------------EDCL---------HYAS---SDDGEDENAIPAYAV---------DH 335
            |                  |||:         .|.|   .|..|:|....|..|         ||
  Rat   368 PSAIKCYVSGVVPAAGEWTEDCVVAVKALLFEQYCSIKVVDISEEEGLTCAVDVVLQSSGKQLDH 432

  Fly   336 RVLDVDY------PRDAVRSAFTLPARD-----IESIIELQQRIRVQLVSLVNPHNFNFWIYNDD 389
            .::::.|      |....:|.....:.|     .|:.|..::...|..|..:|        ..|:
  Rat   433 VLVEMGYGVKPDEPSSKKQSMDPGTSEDTGRLTAENRIGAERNALVPTVLTLN--------VGDE 489

  Fly   390 FKDYEAQFANMQTFY--------------ES-SESKNYTMPL--FLITTDHLCVVRCTSG--WER 435
            |....|.....:.|:              || ||..::..|.  |..|...:|..:.:..  |.|
  Rat   490 FCGVVAHIQTPEDFFCQQLQSGHKLAELQESLSEYCSHVTPRSDFYPTIGDMCCAQFSEDDQWYR 554

  Fly   436 AKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPN--- 497
            |.||.|.|..   ::.|..||.|:...:|.:.:..:|.....||.|.|...||.:    .|:   
  Rat   555 ASVLAYASEE---SVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLAGV----KPSLGM 612

  Fly   498 WTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGW 552
            ||.|.:......:..|::..:|..::...|.:.|||.....| ::.:::|:::|:
  Rat   613 WTPEAICVMRKAVQNRMVTVRVVGMQGTRALVELVDKSVAPH-LSASKALLDSGF 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 1/2 (50%)
TUDOR 379..488 CDD:278965 30/128 (23%)
Tdrd1NP_001099672.1 zf-MYND 162..198 CDD:280009 7/39 (18%)
TUDOR 253..377 CDD:278965 22/137 (16%)
TUDOR 310..356 CDD:119391 15/59 (25%)
TUDOR 486..605 CDD:278965 31/122 (25%)
TUDOR 539..586 CDD:119391 13/50 (26%)
TUDOR 706..824 CDD:278965
TUDOR 760..805 CDD:119391
TUDOR 929..1052 CDD:278965
TUDOR 987..1033 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.