DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and SND1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_055205.2 Gene:SND1 HGNCID:30646 Length:910 Species:Homo sapiens

Alignment Length:747 Identity:116/748 (16%)
Similarity:208/748 (28%) Gaps:299/748 (40%)


  Fly    80 AKSAHIQKLVRCQKKSK---------NRGSH----------KPKYCYASEPSNLVFINESVSKMK 125
            |.:....:|..|::::|         ..|||          .|::...|.....|  |..:..::
Human   141 ANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPV--NAIIEHVR 203

  Fly   126 N----RKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPH------------------IDQMISTG 168
            :    |....|.|.:...:...:..|.:.|......||.                  :..::.:.
Human   204 DGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESC 268

  Fly   169 QQQSTLRT-QRPSFPCNANSKSLKVN-------DWSQKDRKQEPSKERNNQKYPK---------- 215
            ..|:.|.| ..|    |.|...|.:.       |||.....:...|.|..:::.|          
Human   269 HNQNILGTILHP----NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDY 329

  Fly   216 -ITTENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGE-VKEKEDEA 278
             ..|.|..:|:.:.:|:..:.|:.|....    ||....|:......:|.|.:.|| .::|..:.
Human   330 VAPTANLDQKDKQFVAKVMQVLNADAIVV----KLNSGDYKTIHLSSIRPPRLEGENTQDKNKKL 390

  Fly   279 VVLAFDAVSEDGFDLLSMTTTQQ---------------NAVKPLDPPED---------C------ 313
            ..|         :|:..|...::               :.::|..|..:         |      
Human   391 RPL---------YDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIG 446

  Fly   314 ----------------LHYASSDDGEDEN-----AIPAYAVD-------------HRVLD----- 339
                            :.|...||....:     |..|.|:.             |||.|     
Human   447 GINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDT 511

  Fly   340 -------------------VDY-----------PRDAVRSAFTLP-------ARDIESIIE---- 363
                               |:|           |::.....|.|.       ||::..:::    
Human   512 QKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEP 576

  Fly   364 -------------LQQRIRVQLVSLVNPHNFNFWIYNDD-------------------------- 389
                         ||:.:.|::.|:....||..|::.|.                          
Human   577 FSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYK 641

  Fly   390 ----------------FKDYEAQFAN--MQTFYESSESKNYTMPLFL--ITTD------------ 422
                            :..||.|...  |....|...|.:| .|:|:  ||.|            
Human   642 SLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASY-KPVFVTEITDDLHFYVQDVETGT 705

  Fly   423 ----------------------------HLCVVRCTSG-WERAKVLGYRSSNNKMTIEVELVDIG 458
                                        ..|:.:...| |.||:|   ....:...|.|..:|.|
Human   706 QLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARV---EKVESPAKIHVFYIDYG 767

  Fly   459 DIIRVSQQNVKFLIKPFA--LLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEA 521
            :...:....:..|...|:  :||.|......|||...:..:...:.|:.....|........||.
Human   768 NREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEH 832

  Fly   522 IKNNTAYLVLVDTESQGHTVNLNRSLIETGWV 553
            :.....::.|...:|:|   ::...|::.|.|
Human   833 LSAGCPHVTLQFADSKG---DVGLGLVKEGLV 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 3/13 (23%)
TUDOR 379..488 CDD:278965 31/198 (16%)
SND1NP_055205.2 SNc 21..166 CDD:214615 4/25 (16%)
SNc 26..166 CDD:238102 4/25 (16%)
SNc 193..328 CDD:214615 22/141 (16%)
SNc 201..328 CDD:238102 20/131 (15%)
Nuclear localization signal. {ECO:0000255} 321..325 0/4 (0%)
SNc 341..495 CDD:214615 23/167 (14%)
SNc 350..496 CDD:238102 22/159 (14%)
Nuclear localization signal. {ECO:0000255} 388..392 0/4 (0%)
SNc 525..660 CDD:214615 15/135 (11%)
SNc 533..660 CDD:238102 14/127 (11%)
TUDOR 677..799 CDD:278965 22/126 (17%)
TUDOR 728..784 CDD:197660 11/59 (19%)
SNc <844..895 CDD:294094 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.