DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and TDRD7

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_055105.2 Gene:TDRD7 HGNCID:30831 Length:1098 Species:Homo sapiens

Alignment Length:691 Identity:146/692 (21%)
Similarity:251/692 (36%) Gaps:204/692 (29%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTV-TGHG 69
            |..||.|::.:::.|....:.:.:|..:|||..|..:|:.:|||...|::|||:|..|.: |...
Human     3 EGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRS 67

  Fly    70 QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKNR------- 127
            ......|:|..::|.|.:||..|:.|| |.:.:...|.......:.|..|...|...|       
Human    68 GEITCYAMACTETARIAQLVARQRSSK-RKTGRQVNCQMRVKKTMPFFLEGKPKATLRQPGFASN 131

  Fly   128 ----KAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTP-------------HIDQMISTGQQQSTLR 175
                |.|.|.....:...:.|. |:.....|.:||.             |:  .:||..:.|...
Human   132 FSVGKKPNPAPLRDKGNSVGVK-PDAEMSPYMLHTTLGNEAFKDIPVQRHV--TMSTNNRFSPKA 193

  Fly   176 TQRPSFPCNANSKSLK-----VNDWSQKDRKQEPS-----------------KERNN----QKYP 214
            :.:|....:.:..|.|     :|...:|...:.|:                 .:.||    .|.|
Human   194 SLQPPLQMHLSRTSTKEMSDNLNQTVEKPNVKPPASYTYKMDEVQNRIKEILNKHNNGIWISKLP 258

  Fly   215 KITTENKQEKETEELAQAFEN----LSVD----------VAPTDHQEKLKCEIYEDNEDEFVRDP 265
            ....|..:|...:.:.|.||:    .:|:          :.|...::.|:.|:   :.::....|
Human   259 HFYKELYKEDLNQGILQQFEHWPHICTVEKPCSGGQDLLLYPAKRKQLLRSEL---DTEKVPLSP 320

  Fly   266 F---------------IYGEVKEKEDEAVV------------LAFDAVSEDGFDLLSMTTTQQNA 303
            .               :.|:.|||..:.:|            .||:.:.:..|            
Human   321 LPGPKQTPPLKGCPTVMAGDFKEKVADLLVKYTSGLWASALPKAFEEMYKVKF------------ 373

  Fly   304 VKPLDPPEDCL-HYASSDDGEDENAIPAYAVDHRVLDVDY----PRDAVRSA-FTLPA------- 355
                  |||.| :.||..|               |..:||    |:.|:..| ..||.       
Human   374 ------PEDALKNLASLSD---------------VCSIDYISGNPQKAILYAKLPLPTDKIQKDA 417

  Fly   356 ------RDIESIIELQQRIRVQ---------------------------LVSLVNPHNFNFWIYN 387
                  .||::::| |:.::|:                           .|.:|...|.|..:..
Human   418 GQAHGDNDIKAMVE-QEYLQVEESIAESANTFMEDITVPPLMIPTEASPSVLVVELSNTNEVVIR 481

  Fly   388 DDFKDYEAQFANMQTFYESSESKNYTM-PLFLITTDHLCVVRC-TSGWERAKVLGYRSSNNKMTI 450
            ...|||.|....|:...:...|||..: |:..:....|..|.. ...|.||:|:.  :..||  |
Human   482 YVGKDYSAAQELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDAWLRAQVIS--TEENK--I 542

  Fly   451 EVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAF-ITQCKSPNWTAEVVNFFHDMILL-- 512
            :|..||.|     ..:||: ..|.:.|.|:.|   .|:| .|:||...  .||::...|::.:  
Human   543 KVCYVDYG-----FSENVE-KSKAYKLNPKFC---SLSFQATKCKLAG--LEVLSDDPDLVKVVE 596

  Fly   513 RLLYAKVEAI----KNNTAYLVLVDTESQGHTVNLNRSLIE 549
            .|...|:.|:    |.:...:||.||..: ..:|:|.:.::
Human   597 SLTCGKIFAVEILDKADIPLVVLYDTSGE-DDININATCLK 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 27/87 (31%)
TUDOR 379..488 CDD:278965 31/111 (28%)
TDRD7NP_055105.2 LOTUS_1_TDRD7 4..91 CDD:193600 27/87 (31%)
LOTUS_2_TDRD7 234..300 CDD:193587 10/66 (15%)
LOTUS_3_TDRD7 338..404 CDD:193588 20/99 (20%)
TUDOR 459..581 CDD:278965 37/135 (27%)
TUDOR 517..559 CDD:119391 15/52 (29%)
TUDOR 648..775 CDD:278965
TUDOR 707..752 CDD:119391
Interaction with CDK17. {ECO:0000250} 861..1098
Interaction with CABLES1. {ECO:0000250} 893..1098
TUDOR 909..1026 CDD:278965
TUDOR 963..1007 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.