DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Tdrd5

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001128213.1 Gene:Tdrd5 MGIID:2684949 Length:1040 Species:Mus musculus

Alignment Length:690 Identity:146/691 (21%)
Similarity:244/691 (35%) Gaps:192/691 (28%)


  Fly    10 VKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVT--GHGQMA 72
            ::|.:.||::|:...||.:||.::|....|..||...||::.....:..:||.|:|.  |.|.:.
Mouse    11 LRKEIRSLLISTKDGLTPQQLEKEYLLMVGNHLPLRILGYRSTMELVLDMPDVVSVCPGGDGTVI 75

  Fly    73 WITAVATAKSAHIQKLVRCQKKSKNRGSHK---------PKYCYASEP----------------- 111
             :.|:....:..|..||     :|.|.|||         |..|....|                 
Mouse    76 -LKAIPDESTKGIASLV-----AKQRRSHKVRNSMPKGRPSICSGRVPYRGRVPPILPAVVKSEL 134

  Fly   112 ------------------------------------------------------SNLVFINESVS 122
                                                                  .:|:.:.:|||
Mouse   135 KDLLALSPVLLSDFEKAFARRFGRSFQYMQYGFLSMFEVLNAASDVISVEQTRAGSLLTLKKSVS 199

  Fly   123 KMKNRKAPF-PTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQ--QQSTLRTQRPSFPCN 184
            :.|.|..|. ..:..|..:|...||...    :||...|..|.||..:  :|.....:.|:|   
Mouse   200 EDKQRGWPAGKVFTQPFRMKQQGSYSTG----FPVMKAHFSQPISNMEPPKQVLSMAKTPTF--- 257

  Fly   185 ANS-KSLKVNDWSQKDRKQ----------------EPSKERNNQ----KYP------KITTE--- 219
             || ::.::|...:.::.:                :|..:|..|    |:|      |:..|   
Mouse   258 -NSVEASRLNHTEKLNQLESTFKSVIAQIGPGGTVDPELKRKIQFVVSKFPQGLFISKLLGEFEL 321

  Fly   220 -NKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRD----PFIYGEVKEKEDEAV 279
             .|::...::|  .|.|::..|...  .:.|:.|..|:.:|..|.|    |...|........:.
Mouse   322 TFKEQLSPKQL--GFLNVTELVGAL--SDILRVEFSEERQDLLVFDADLKPLPSGGPLSSVRNSC 382

  Fly   280 VLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAI---PAYAVDHRVLDV- 340
            ::..|..:|......|::....:.|.......||   ...:..|.|..|   |...|....|.| 
Mouse   383 LVQPDKKTEANPWTSSLSRNSLSTVAVKKTTWDC---PLKNQKEPEQKIYKKPNLVVKPLQLQVE 444

  Fly   341 -------------DYPRDAVRS--AFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDF 390
                         |.|.||||:  ...||..|..::      :.|.:..:::|..|...||:.|.
Mouse   445 TNKPQLSLSVANHDIPPDAVRAKKLCRLPPLDTSTL------VGVFVEYIISPSQFYIRIYSRDS 503

  Fly   391 KD-YEAQFANMQTFYESS-ESKNYTMPLFLITTDHLCVVRCTSG--WERA---KVLGYRSSNNKM 448
            .: .|.....|:..|.:. .|..|.||.:.|...|||.|:.:..  |.|.   ::||      |.
Mouse   504 SELLEDMMIEMRRCYSNQLVSDRYIMPEYFIQPGHLCCVKISEDKWWYRVIIHRILG------KK 562

  Fly   449 TIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLR 513
            .:||...|.|:|..|.:.:::||...:..||.|.:...||::...:. :|||..:..|..:..|:
Mouse   563 EVEVFYPDFGNIGTVQKSSLRFLKCCYTKLPAQAIPCSLAWVRPAEE-HWTARAILHFQKLCGLK 626

  Fly   514 LLYAKVEAIKNNTAYLVLVDTES------------QGHTV 541
            .|...|:...:....:.|.||.|            :||.:
Mouse   627 PLVGVVDEYIDGILNIFLCDTSSNEDVYFHHVLRTEGHAI 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 24/85 (28%)
TUDOR 379..488 CDD:278965 33/116 (28%)
Tdrd5NP_001128213.1 LOTUS_1_TDRD5 4..98 CDD:193599 27/93 (29%)
LOTUS_2_TDRD5 127..196 CDD:193589 1/69 (1%)
LOTUS_3_TDRD5 292..365 CDD:193590 18/77 (23%)
TUDOR 483..602 CDD:278965 35/125 (28%)
TUDOR 537..583 CDD:119391 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4918
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005690
OrthoInspector 1 1.000 T1082289
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22948
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.