DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and Tdrd6

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001154838.1 Gene:Tdrd6 MGIID:2679727 Length:2135 Species:Mus musculus

Alignment Length:609 Identity:118/610 (19%)
Similarity:205/610 (34%) Gaps:188/610 (31%)


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGHG- 69
            ||.|.::|..||..|         |::.|.:..|       .|...|....|:.|.    ..|. 
Mouse   193 ELGLARQVPDSLFCS---------LLKRYLTAAG-------QGSSGAPVLPRAAPK----QEHPG 237

  Fly    70 --------QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKN 126
                    |:.....|...:..|..: :.||.:|.::..|:              ::||::::  
Mouse   238 LDYFYPQLQLGVTEPVVVTQVCHPHR-IHCQLRSLSQEIHR--------------LSESMAQV-- 285

  Fly   127 RKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLK 191
                   |:.                  ||.|...|...:|.:::.. ...:|..||        
Mouse   286 -------YRA------------------PVGTDDEDSGSATWEEREE-SPDKPGSPC-------- 316

  Fly   192 VNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYED 256
                        .|...:.|.|..:..|..:.:...::      |.||..   .:|.:.|.....
Mouse   317 ------------ASCGLDGQWYRALLLETFRPQRCAQV------LHVDYG---RKELVSCSSLRY 360

  Fly   257 NEDEFVRDPFI--------------------YGEVKEKEDEAVVL------------AFDAV--- 286
            ...|:.|.|.:                    .|::|     |::|            :|:.:   
Mouse   361 LLPEYFRMPVVTYPCALYGLWDCGRGWSRSQVGDLK-----ALILGQAVNAKIEFYCSFEHMYYV 420

  Fly   287 ---SEDGFDLLSMTTTQQNAVKPLDPPEDCL--HYASSDDGEDENAIPAYAVDHRVLDVDYPRDA 346
               .|||.:|.|....|          ..||  .:..|...|:|.              :...|.
Mouse   421 TLYGEDGINLNSAFGVQ----------SCCLADWFLQSQGIEEEE--------------EEDEDE 461

  Fly   347 VRSAF--TLPARDIESIIELQ--QRIRVQL-------VSLVNPHNFNFWIYNDDFKDYEAQFANM 400
            |.:||  ..||.::|:.:.|.  :.||:::       |..|...: .|||.....|:..::....
Mouse   462 VEAAFQSQSPAEEMEAEVSLPSLRSIRLKMNTFYDAQVEFVKSPS-EFWIRLRKHKNTFSKLTKR 525

  Fly   401 QTFYESSESKNYTMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQ 465
            ...:.||.||...:.|.....|..||....:|:.||.|....|.    :::|.|||.|:...|..
Mouse   526 MCSFYSSASKLDGVILRPEPDDLCCVKWKENGYYRATVTRLDSK----SVDVFLVDRGNSENVDW 586

  Fly   466 QNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLV 530
            .:|:.|:..|..||...|...||.|... ...|:.|..:||...:|.:.|...| ..|.:..|::
Mouse   587 CDVRMLLPQFRQLPILALKCTLADIWPL-GKTWSQEATSFFKKTVLHKELVVHV-LDKQDHQYVI 649

  Fly   531 LVDTESQGHTVNLNRSLIETGWVR 554
            .:..||:....|:::.:.:.|:.:
Mouse   650 EILDESRMGEENISKVIAQAGFAK 673

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 19/95 (20%)
TUDOR 379..488 CDD:278965 30/109 (28%)
Tdrd6NP_001154838.1 TUDOR 10..133 CDD:278965
TUDOR 245..379 CDD:278965 30/206 (15%)
TUDOR 313..359 CDD:119391 11/75 (15%)
TUDOR 489..610 CDD:278965 33/126 (26%)
TUDOR 547..591 CDD:119391 15/48 (31%)
TUDOR 773..890 CDD:278965
TUDOR 826..869 CDD:119391
TUDOR 987..1106 CDD:278965
TUDOR 1042..1084 CDD:119391
TUDOR 1309..1428 CDD:278965
TUDOR 1362..1406 CDD:119391
TUDOR 1519..1641 CDD:278965
TUDOR 1574..1621 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.