DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and tsn-1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_494839.1 Gene:tsn-1 WormBaseID:WBGene00006626 Length:914 Species:Caenorhabditis elegans

Alignment Length:522 Identity:101/523 (19%)
Similarity:167/523 (32%) Gaps:184/523 (35%)


  Fly     5 GELSLVKKVVHSLVVSSPGKLTVEQL-----MRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVT 64
            |:|:..|:.:..|......:..||.|     :|.|..:|...:.: .||..:.....|..|..|:
 Worm   508 GDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITF-LLGGINCPKGARVGPGGVS 571

  Fly    65 VTGHGQMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLV-FINESVSKMKNRK 128
             ||..:.....|.|..:...:|..|:.:.:|.::..:...|.|.|...|.. .||.|.:.::|..
 Worm   572 -TGAAEPFADEAAAFTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEALVENGL 635

  Fly   129 APFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLKVN 193
            |.. .:...|:       .:||.||                            .....:|..|.|
 Worm   636 ASL-HFTAERS-------GHYNALL----------------------------SAENKAKKAKKN 664

  Fly   194 DWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSV-DVAPTDHQEKLKCEIYEDN 257
            .|:.       ..|..:|:..::     |:.:|.|..|.|..::| |:||.              
 Worm   665 IWAN-------FTEEQHQEEVEV-----QQADTSERKQNFRQVAVTDIAPG-------------- 703

  Fly   258 EDEFVRDPFIYGEVKEKEDEAVVLAFDAVS-EDGFDLLSMTTTQQNAVKPLDPP---------ED 312
                                  .|.|.|.: |||..:..|||..:.|:.. .||         .|
 Worm   704 ----------------------ALRFSAQNIEDGPKIEKMTTEMRQALAE-HPPLAGSYTTKRGD 745

  Fly   313 CLHYASSDDGE-----DENAIPAYAVDHRVLDVDYPR----DAVRSA--------FTLPARDIE- 359
            ......|.||:     .|:.....|   .::.:||..    :||:.|        |....|:.. 
 Worm   746 LCVAKFSQDGQWYRCKVESVRAGQA---EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNL 807

  Fly   360 SIIELQQRIRVQLVSLVNPHNFNFWIYNDDFKDYEAQFANMQTFYESSESKNYTMPLFLITTDHL 424
            ::.:|.....|||.|             |.|..|  .|.:...|. :||.|       :.|::::
 Worm   808 ALAKLPNEDYVQLTS-------------DAFAQY--LFGHSSVFI-NSEYK-------VGTSEYV 849

  Fly   425 CVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIG-----------------------DIIRVSQQ 466
            .|.             |.|.|.|:.|...|:..|                       ::.|.|::
 Worm   850 TVY-------------YDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRK 901

  Fly   467 NV 468
            |:
 Worm   902 NI 903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 20/91 (22%)
TUDOR 379..488 CDD:278965 20/114 (18%)
tsn-1NP_494839.1 SNc 22..168 CDD:214615
SNc 30..168 CDD:238102
SNc 193..328 CDD:214615
SNc 201..328 CDD:238102
SNc 341..492 CDD:214615
SNc 350..492 CDD:238102
SNc 524..668 CDD:214615 36/182 (20%)
SNc 536..668 CDD:238102 33/170 (19%)
TUDOR 687..808 CDD:278965 32/161 (20%)
TUDOR 744..788 CDD:119391 10/47 (21%)
SNc 758..904 CDD:214615 34/186 (18%)
SNc <850..906 CDD:294094 11/68 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.