DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tej and ekl-1

Sequence 1:NP_610950.2 Gene:tej FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_492009.1 Gene:ekl-1 WormBaseID:WBGene00009052 Length:606 Species:Caenorhabditis elegans

Alignment Length:492 Identity:95/493 (19%)
Similarity:173/493 (35%) Gaps:173/493 (35%)


  Fly   106 CYASEPSNLVFINESV---------SKMKNRKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHI 161
            |..:|...:.||:::|         .::......:|...:..::.......:.||....:.:|.|
 Worm   118 CRNNELLKVFFIDDAVIAWVQPECLGELDQHYMYYPWQAIQVSMFGATPTVDVNRSTEQLWSPII 182

  Fly   162 -DQMISTGQQQSTLRTQ--RPSFPCNANSKSLKVN------DWSQKDR------------KQEP- 204
             ||:....:|...||.:  ..:...|..:|.:.||      |..:||:            :||| 
 Worm   183 CDQLSKVLEQFFILRVEVVLSTVVFNDYAKPIPVNLFGIEADIDEKDQIRRAIEIGPILERQEPV 247

  Fly   205 ---SKERNNQKYPKITTENKQE---KETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVR 263
               ..|..:..|.::....::|   .|..|:.::|        |||.:   |..|.||       
 Worm   248 GISFPEFFDAAYHQVFEVAERETIPNEALEIHRSF--------PTDWK---KTSISED------- 294

  Fly   264 DPFIYGEVKEKEDEAVVLAFDAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGE----- 323
                  ::||::::|:           |...|:....:::  ..||.::.:...|.|..|     
 Worm   295 ------QMKEEKEKAL-----------FSKNSLIPEMEHS--DWDPRQNSIEMLSIDQLEEKFKF 340

  Fly   324 --DENAIPA--YAVDHRVLDVDYPRDAVRSAFTLPARDI---------ESII-----ELQQRIRV 370
              |.:..||  .||:.|         ..:|.|...||.|         |.:|     :|::    
 Worm   341 PYDSDVAPAIMLAVEGR---------CTKSPFEWYARPIVKTGRNANGEMVIWNDEEQLKE---- 392

  Fly   371 QLVSLVNPHNFNFWIY-NDDFKDYEAQFANMQTFYESSESKNYTMPL---------------FLI 419
                 |:|  .::.|| ||.......|   :.|:|.:.:::.   ||               |.:
 Worm   393 -----VDP--VDWMIYGNDQLLSMAEQ---LDTYYSNPKNRK---PLKAEEIQSMRKEKRDVFAV 444

  Fly   420 TTDHLCVVR-----CTSGWERAKV--------LGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFL 471
                 |.|.     .|..|:|..:        :.:..|..:     ::|..|.:.::.:|:.:| 
 Worm   445 -----CAVNEEKAMYTGEWQRVLIVECDTFAEVRFLDSGGR-----DMVLTGSLYKIHRQHCRF- 498

  Fly   472 IKPFALLPRQCLAGRLAFITQCKS--PNWT-AEVVNF 505
                   |..||...:..||..:|  ..|| ||...|
 Worm   499 -------PPMCLRLSMHGITSSESVVRKWTSAETSRF 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 23/138 (17%)
ekl-1NP_492009.1 TUDOR 48..163 CDD:278965 6/45 (13%)
TUDOR 93..149 CDD:197660 5/31 (16%)
TUDOR 443..495 CDD:197660 9/62 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.